0

equations of the form b g dt f

Báo cáo y học:

Báo cáo y học: "Study of the early steps of the Hepatitis B Virus life cycle"

Y học thưởng thức

... cells but not the < /b> rat hepatocytes This binding could be inhibited by recombinant HBs but not by the < /b> recombinant LHBs The < /b> binding of < /b> SHBs with human hepatocytes was further supported by the < /b> observation ... viral infection There are differing reports about the < /b> role of < /b> MHBs in the < /b> generation of < /b> HBV in the < /b> transfected cells and in mediating HBV infection [8, 26] MHBs seem to be absent in certain HBV variants ... refractory for HBV infection [5, 15, 16, 17] Although there is a growing body of < /b> data, recently most of < /b> the < /b> published information about the < /b> early stages of < /b> hepadnavirus infection is derived from...
  • 13
  • 654
  • 1
Tài liệu Báo cáo khoa học: Limited suppression of the interferon-b production by hepatitis C virus serine protease in cultured human hepatocytes pptx

Tài liệu Báo cáo khoa học: Limited suppression of the interferon-b production by hepatitis C virus serine protease in cultured human hepatocytes pptx

Báo cáo khoa học

... suppression of < /b> the < /b> IFN system by HCV NS3-4A T-pIC treatment (Fig 4C), but none of < /b> these NS3-4As could suppress the < /b> induction of < /b> IFN -b mRNA following M-pIC treatment (Fig 4D) We next examined the < /b> effects ... performed as described in Fig 1A (B) Effect of < /b> NS3-4A on IRF-3 dimerization induced by the < /b> ectopic expression of < /b> TRIF in PH5CH8 cells The < /b> dimerization analysis of < /b> IRF-3 was performed as described ... lysate of < /b> PH5CH8 cells transfected with the < /b> pCX4bsr vector was used as a control (NS–) (A) Effect of < /b> NS3-4A on the < /b> IFN -b gene promoter activated by T-pIC treatment (B) Effect of < /b> NS3-4A on the < /b> IFN-b...
  • 16
  • 523
  • 0
Tài liệu Báo cáo khoa học: Long-distance interactions between enhancers and promoters The case of the Abd-B domain of the Drosophila bithorax complex pdf

Tài liệu Báo cáo khoa học: Long-distance interactions between enhancers and promoters The case of the Abd-B domain of the Drosophila bithorax complex pdf

Báo cáo khoa học

... of < /b> the < /b> boundaries within BX-C is to separate neighboring cis-regulatory regions, and to Fig Model of < /b> the < /b> regulation of < /b> the < /b> Abd -B gene in abdominal segments A6 and A7 Although the < /b> iab-5 cis-regulatory ... on the < /b> chicken beta-globin gene cluster are greatly hindered in the < /b> case of < /b> Abd -B by the < /b> fact that the < /b> chromatin topology of < /b> the < /b> latter is likely to be different in different segments Hopefully, ... timing of < /b> somatic pairing perhaps reflects the < /b> difference between the < /b> complexities of < /b> the < /b> regulation of < /b> the < /b> two systems: a longer time is required for the < /b> formation of < /b> the < /b> complex looping structure...
  • 7
  • 719
  • 0
Báo cáo khoa học: Functional analysis of the aglycone-binding site of the maize b-glucosidase Zm-p60.1 pot

Báo cáo khoa học: Functional analysis of the aglycone-binding site of the maize b-glucosidase Zm-p60.1 pot

Báo cáo khoa học

... F4 61L and F4 61L in P2, 5¢-CGTTCGGTGAAGCCGGCCAGC CATTCAAAGTTGTC-3¢; mutations W373K and W373K in P2, 5¢-GGGTACATGTAGATTTTTGGATTTCCCA TAG-3¢; mutations F2 00K and F1 93A in P2, 5¢-GCACC GACCTGGGGCTTTGACCCCAGTTCCGTAGGACGC ... described previously [13,19,20] The < /b> mutagenic oligonucleotides were as follows: mutation F1 93A, 5¢-AGTTCCGTAGGACGCGGAAGTA AATGTGTC-3¢; mutation F2 00K, 5¢-CACCGACCTGGG GCTTTGACCCCAGTTCCGTAG-3¢; ... architecture of < /b> the < /b> aglycone-binding site of < /b> Zm-p60.1 differs distinctly from that of < /b> Bgl4:1 and its homologs These findings offer exciting prospects for comparative analysis of < /b> the < /b> molecular...
  • 13
  • 400
  • 0
Báo cáo khoa học: CpG methylation of the CENP-B box reduces human CENP-B binding pptx

Báo cáo khoa học: CpG methylation of the CENP-B box reduces human CENP-B binding pptx

Báo cáo khoa học

... atom of < /b> guanine 16 by the < /b> CpG methylation may be a reason for the < /b> reduced specificity of < /b> CENP -B to the < /b> CENP -B box sequence What is the < /b> functional meaning of < /b> the < /b> CpG methylation of < /b> the < /b> CENP -B box ... and of < /b> the < /b> CENP -B box DNA reduces the < /b> CENP -B binding affinity almost to the < /b> level of < /b> nonspecific DNA binding A Discussion B Fig CpG methylation reduces the < /b> affinity between CENP -B and the < /b> CENP -B box ... al revealed that the < /b> presence of < /b> the < /b> CENP -B box is essential for the < /b> formation of < /b> functional minichromosomes [15,16] Therefore, the < /b> CENP -B box is required for the < /b> formation of < /b> a functional centromere...
  • 8
  • 497
  • 0
The fabric of the cosmos   b  greene

The fabric of the cosmos b greene

Vật lý

... toward filling in the < /b> gaps ieft by the < /b> big bang model -of < /b> explaining the < /b> shape of < /b> space and the < /b> uniformity of < /b> the < /b> microwave radiation, and also of < /b> suggesting why the < /b> early universe might have been ... of < /b> organizing the < /b> content of < /b> the < /b> block- that is, of < /b> organizmg the < /b> events of < /b> 'Like the < /b> pages In any fl ip book, the < /b> pages In Figure 3.3 only sho\il representatwe moments of < /b> time T h ~ may suggest ... an Infinite number of < /b> pages interpolat~ilg between those shown 54 Relativity and the < /b> Absoiute THE < /b> FABRIC OF < /b> THE < /b> CCShlOS Figure 3.3 (a) Flip book of < /b> duel (b) Flip book with expanded binding spacetlme...
  • 289
  • 244
  • 0
Báo cáo khoa học: Direct CIII–HflB interaction is responsible for the inhibition of the HflB (FtsH)-mediated proteolysis of Escherichia coli r32 by kCIII docx

Báo cáo khoa học: Direct CIII–HflB interaction is responsible for the inhibition of the HflB (FtsH)-mediated proteolysis of Escherichia coli r32 by kCIII docx

Báo cáo khoa học

... aliquot of < /b> bound GST–H B (25 lg) was mixed with 30 lg of < /b> r32 in buffer P The < /b> final volume was made up to 500 lL and incubated overnight on a rotating machine at °C Before binding, 5% of < /b> the < /b> input ... CIII for binding to H B would also decide the < /b> extent and efficiency of < /b> protection of < /b> r32 by CIII, because both are H B substrates The < /b> relative binding affinity for r32–H B interaction and CIII–H B ... with 40 mL of < /b> buffer L followed by 10 mL of < /b> buffer L plus 15 mm imidazole Nickel-bound proteins were eluted with 30 mL of < /b> 15–150 mm imidazole gradient in buffer L Pure fractions of < /b> r32 proteins...
  • 6
  • 453
  • 0
Báo cáo khoa học: Mechanism for transcriptional synergy between interferon regulatory factor (IRF)-3 and IRF-7 in activation of the interferon-b gene promoter docx

Báo cáo khoa học: Mechanism for transcriptional synergy between interferon regulatory factor (IRF)-3 and IRF-7 in activation of the interferon-b gene promoter docx

Báo cáo khoa học

... observation of < /b> a strong threshold effect, even with the < /b> IRF-3E7/IRF-7Di-containing set (Fig 5B) , further suggests that the < /b> binding of < /b> the < /b> set of < /b> virus-activated transcription factors to the < /b> IFN -b promoter ... C2-regions of < /b> p300, and to the < /b> N- and C2-regions of < /b> CBP Thus, the < /b> bulk of < /b> the < /b> interaction between NF-jB and p300/CBP is mediated by the < /b> p65 subunit through the < /b> N- and C-terminal regions of < /b> the < /b> ... IRF3 0.25 ug +IRF7 0.5 ug All + IRF3 0.5 ug Fig Mechanism of < /b> synergistic activation of < /b> the < /b> IFN -b promoter in S2 cells (A) Activation of < /b> the < /b> )110IFNbCAT reporter by the < /b> transcription factors (TFs;...
  • 11
  • 487
  • 0
Báo cáo khoa học: Interactions of the antimicrobial b-peptide b-17 with phospholipid vesicles differ from membrane interactions of magainins potx

Báo cáo khoa học: Interactions of the antimicrobial b-peptide b-17 with phospholipid vesicles differ from membrane interactions of magainins potx

Báo cáo khoa học

... ratio Fitting the < /b> transition to one component provides a measure of < /b> the < /b> average effect of < /b> the < /b> b- peptide on the < /b> curvature properties of < /b> the < /b> lipid measurements were performed in mL of < /b> buffer composed ... of < /b> Ole2PtdGro to eggPtdCho produced a titration curve similar to that of < /b> the < /b> other LUV containing anionic lipids The < /b> two modes of < /b> binding observed could be explained by aggregation at the < /b> high ... summarized by showing the < /b> dependence of < /b> the < /b> percentage leakage at 300 s on the < /b> b- peptide to lipid ratio (Fig 5) In Fig 6, leakage Fig Leakage from 25 lM LUVs of < /b> Ole2PtdEtn/Ole2PtdGro (1 : 2)...
  • 9
  • 266
  • 0
Báo cáo Y học: Barley a-amylase Met53 situated at the high-affinity subsite )2 belongs to a substrate binding motif in the bfia loop 2 of the catalytic (b/a)8-barrel and is critical for activity and substrate specificity pot

Báo cáo Y học: Barley a-amylase Met53 situated at the high-affinity subsite )2 belongs to a substrate binding motif in the bfia loop 2 of the catalytic (b/a)8-barrel and is critical for activity and substrate specificity pot

Báo cáo khoa học

... YSVGYDSYDLFDLGE LSQS -DNGYGPYDLYDLGE TSQA -DVGYGAYDLYDLGE KSE YAYHGYHTYDFYAVDG IHGWVGGGTKGDFPHYAYHGYYTQDWTNLDA FSSWTDGGKS -GGGEGYFWHDFNKNGR ASQN -DVGYGAYDLYDLGE EHNWVSSGDGAP ... SFLDSIIQNGYAFEDRYDLAM SSGDTNYGGMSFLDSFLNNGYAFTDRYDLGF KCPEG KSDGGYAVSSYRDVNP SSIS -FHGYDVVDFYSFKA PTG YGDSPYQSFSAFAGNP DTG SCSSPYNSISSIALNP PTG FGNSPYLCYSALAINP PPGKR GNEDGSPYSGQDANCGNT ... -VHGYDTYDYYTVDP MASPG -SNHGYDVIDHSRIND QNDANDVVPNS-DANQNYWGYMTENYFSPDR FATINYSGVTN TAYHGYWARDFKKTNP GDRGF -APADYTRVDAAFGDW ASSDK -SFLDAIVQNGYAFTDRYDIGY VSSEDG SFLDSIIQNGYAFEDRYDLAM...
  • 14
  • 557
  • 0
Báo cáo lâm nghiệp:

Báo cáo lâm nghiệp: "Influence of the form of nitrogen nutrition reductase activity in young black locus" doc

Báo cáo khoa học

... activity (Fig 2) After 72 h of < /b> induction, the < /b> highest NR activity was found in the < /b> apical fully expanded leaf and corresponded with the < /b> highest nitrate content (Table I) When a new leaf expanded, the < /b> ... Effect of < /b> nitrate of < /b> leaf NR activity of < /b> nodulafed plants Administration of < /b> mM NaN0 to 11 mo old nodulated plants did not increase leaf NR activity, whereas the < /b> 10 mM NaN0 dose induced high ... in the < /b> previous leaf and the < /b> highest enzyme activity was found again in the < /b> new leaf (Fig 2) When the < /b> nitrate supply was withdrawn, the < /b> enzyme activity recovered its minimum value after d (Fig...
  • 4
  • 202
  • 0
Báo cáo y học:

Báo cáo y học: " Reconstitution of the adult B cell repertoire after treatment with rituximab" pptx

Báo cáo khoa học

... nonquantitative nature of < /b> the < /b> bulk PCR approach employed by the < /b> investigators Furthermore, for most of < /b> the < /b> study total B cells were studied without differentiating specific B cell subsets This situation ... Ultimately, the < /b> quality of < /b> the < /b> emerging repertoire will depend to a large extent on the < /b> interplay and competition between these cells and newly generated B cells The < /b> growing availability of < /b> patients ... understanding of < /b> basic aspects of < /b> B cell biology and homeostasis Competing interests The < /b> authors have received grant support from Genentech for the < /b> study of < /b> rituximab in SLE Acknowledgments This work was...
  • 2
  • 231
  • 0
Báo cáo y học:

Báo cáo y học: "Baicalein inhibits IL-1β- and TNF-α-induced inflammatory cytokine production from human mast cells via regulation of the NF-κB pathway" pot

Báo cáo khoa học

... as follows: HPRT: 5' CGA GAT GTG ATG AAG GAG ATG G 3' and 5' GGA TTA TAC TGC CTG ACC AAG G 3'; IL-6: 5' ATG AAC TCC TTC TCC ACA AGC GC 3' and 5' GAA GAG CCC TCA GGC TGG ACT G 3'; IL-8: 5' ATG ... translocation of < /b> NF- B was analyzed by the < /b> EMSA using the < /b> nuclear fraction Seven micrograms of < /b> nuclear protein were added to ml of < /b> binding buffer (Promega, Madison, WI), and 35 fmol of < /b> double stranded NF- B ... ,QWHQVLW\ ,QGH[ ,/ Figure 4analysis of < /b> effects of < /b> BAI on the < /b> gene expression of < /b> IL-6, IL-8, and MCP-1 in IL-1β- and TNF-α-activated HMC-1 cells RT-PCR RT-PCR analysis of < /b> effects of < /b> BAI on the < /b> gene expression...
  • 10
  • 207
  • 0
geography of the world b

geography of the world b

Anh ngữ cho trẻ em

... oranges, lemons, and grapefruit, are grown AT PRAYER Judaism is one of < /b> the < /b> world’s oldest religions Jews believe in one God and follow the < /b> teachings of < /b> the < /b> Torah, the < /b> first five books of < /b> the < /b> Bible ... SUBCONTINENT FRINGED BY THE < /b> INDIAN OCEAN, the < /b> Arabian Sea, and the < /b> Bay of < /b> Bengal, and bordered to the < /b> north by the < /b> mighty Himalayas, the < /b> Indian Subcontinent covers a vast area More than a fifth of < /b> the < /b> ... make their living from fishing Fish are laid out to dry in the < /b> sun so that they can be stored SINGAPORE OFF THE < /b> TIP OF < /b> MALAYSIA SINGAPORE lies the < /b> tiny island state of < /b> Singapore, one of < /b> the < /b> most...
  • 151
  • 251
  • 0
QUY TRÌNH các bước để XIN GIẤY CHỨNG NHẬN XUẤT xứ (CERITIFICATE OF ORIGIN) FORM b đối với mặt HÀNG gạo (THƠM)

QUY TRÌNH các bước để XIN GIẤY CHỨNG NHẬN XUẤT xứ (CERITIFICATE OF ORIGIN) FORM b đối với mặt HÀNG gạo (THƠM)

Năng lượng

... (tiếng Anh) Nhập thông tin người nhận hàng (2) (tiếng Anh) Nhập thông tin vận chuyển (3) (tiếng Anh) Nhập thông tin hàng hóa (4) (tiếng Anh) Nhập thông tin trọng lượng số lượng (5) (tiếng Anh) ... đơn thương mại thể mua b n hàng hóa doanh nghiệp tự làm, thể đầy đủ tên doanh nghiệp, người mua hàng, số invoice, số Hợp đồng, số vận đơn, cảng b c, cảng dỡ, mô tả hàng hóa, trọng lương tịnh, ... sau in mẫu C/O mua VCCI (form < /b> B) C/O sau hoàn tất chuẩn b chính, y để nộp xin xác nhận Sau form < /b> mẫu C/O doanh nghiệp 2.3 C/O giấy bao g m chứng từ chọn phần B chứng từ” đơn xin cấp C/O khai:...
  • 21
  • 1,258
  • 7
Structure and rheology of mixtures of the protein b lactoglobulin and the polysaccharide k carrageenan

Structure and rheology of mixtures of the protein b lactoglobulin and the polysaccharide k carrageenan

Tổng hợp

... K+-induced gelation of < /b> κ-car The < /b> strong influence of < /b> CaCl2 on Κ+-induced gelation of < /b> κ-car is caused by effective screening of < /b> the < /b> electrostatic interactions between the < /b> helices The < /b> effect of < /b> adding a ... (Val/Ala) β-lg has been the < /b> subject of < /b> a wide range of < /b> biophysical studies because of < /b> its abundance and ease of < /b> isolation from milk Its biological function is not clear, but it is a member of < /b> the < /b> lipocalin ... of < /b> the < /b> aggregation and gelation of < /b> κ-carrageenan (b) (a) G 10-1 G , G (Pa) G , G (Pa) 10o Triangles - cooling Circles - heating G G G 10-2 20 10 T (oC) T (oC) Figure 1.8 (a) Evolution of...
  • 131
  • 271
  • 0
Structure and rheology of mixtures of the protein b lactoglobulin and the polysaccharide k carrageenan

Structure and rheology of mixtures of the protein b lactoglobulin and the polysaccharide k carrageenan

Khoa học tự nhiên

... Effect of < /b> the < /b> size and morphology of < /b> the < /b> β-lg aggregates 57 4.4.2 Effect of < /b> κ-carrageenan gelation on the < /b> structure 59 4.4.3 Effect of < /b> κ-carrageenan gelation on the < /b> rheology ... (Val/Ala) β-lg has been the < /b> subject of < /b> a wide range of < /b> biophysical studies because of < /b> its abundance and ease of < /b> isolation from milk Its biological function is not clear, but it is a member of < /b> the < /b> lipocalin ... of < /b> the < /b> aggregation and gelation of < /b> κ-carrageenan (b) (a) G 10-1 G , G (Pa) G , G (Pa) 10o Triangles - cooling Circles - heating G G G 10-2 20 10 T (oC) T (oC) Figure 1.8 (a) Evolution of...
  • 132
  • 288
  • 0
Tài liệu Engineering Mechanics - StaticsChapter 1Problem 1-1 Represent each of the following combinations of units in the correct SI form using an appropriate prefix: (a) m/ms (b) μkm (c) ks/mg (d) km⋅ μN Units Used: μN = 10−6N kmμkm = 109−6Gs = 10 s pptx

Tài liệu Engineering Mechanics - StaticsChapter 1Problem 1-1 Represent each of the following combinations of units in the correct SI form using an appropriate prefix: (a) m/ms (b) μkm (c) ks/mg (d) km⋅ μN Units Used: μN = 10−6N kmμkm = 109−6Gs = 10 s pptx

Kĩ thuật Viễn thông

... Determine the < /b> magnitude and direction of < /b> the < /b> resultant FR = F + F2 + F of < /b> the < /b> three forces by first finding the < /b> resultant F' = F1 + F and then forming F R = F' + F Given: F = 30 N F = 20 N F = 50 ... the < /b> resultant FR = F1 + F2 + F3 of < /b> the < /b> three forces by first finding the < /b> resultant F' = F + F and then forming F R = F' + F Given: F = 30 N F = 20 N 29 © 2007 R C Hibbeler Published by Pearson Education, ... components of < /b> each force acting on the < /b> gusset plate of < /b> the < /b> bridge truss Given: F = 200 lb c = F = 400 lb d = F = 300 lb e = F = 300 lb f = Solution: F 1x = F F 1x = −200 lb F 1y = lb F 2x = F ⎛ ⎜ d ⎞...
  • 1,119
  • 1,071
  • 2
Tài liệu I MMIGRANT S MALL B USINESS OWNERS: A S IGNIFICANT AND G ROWING PART OF THE E CONOMY pdf

Tài liệu I MMIGRANT S MALL B USINESS OWNERS: A S IGNIFICANT AND G ROWING PART OF THE E CONOMY pdf

Ngân hàng - Tín dụng

... industry by race and ethnicity Agriculture, forestry, fishing, and hunting Mining Construction Share of < /b> Share of < /b> Share of < /b> Foreign- foreignborn born Foreign- foreign- Foreign- foreignborn born Hispanic/ ... immigrant share of < /b> labor force higher than immigrant share of < /b> population largely because immigrants are a bigger share of < /b> the < /b> working-age population In some metro areas, immigrant share of < /b> the < /b> ... and labor force (4 percent), but is in the < /b> top half of < /b> the < /b> 50 states plus the < /b> District of < /b> Columbia (at 20th) in the < /b> ratio of < /b> foreign-born share of < /b> business owners to U.S.-born share In Alabama,...
  • 37
  • 436
  • 0
Báo cáo khoa học: Crystal structures of the apo form of b-fructofuranosidase from Bifidobacterium longum and its complex with fructose pot

Báo cáo khoa học: Crystal structures of the apo form of b-fructofuranosidase from Bifidobacterium longum and its complex with fructose pot

Báo cáo khoa học

... MTDFTPETPVLTPIRDHAAELAKAEAGVAEMAAKRNN-RWYPKYHIASNGGWINDPNGLCFY KGRWHVFYQLHPYGTQWG-PMHWGHV LFKPNYHFFPITGWMNDPNGLIFW KGKYHMFYQYNPRKPEWG-NICWGHA FNYDQ-PYRGQYHFSPQKNWMNDPNGLLYH NGTYHLFFQYNPGGIEWG-NISWGHA ... -GPPGTVGSGTQYFVGEFDG-T-TFTPDADTVYPGNST-Y-YGNQYECPGLIEVPIEN-S -DKSKWVMFLAINPG -SPLGGSINQYFVGDFDG -F- QFVPDD -SQ DGSGMWECPDFFPVTR -F- GSNGVETSSFGEPNEILKHVLKISLDD TKHDYYTIGTYDRVKDKFVPDN GFK -DATGTWECPDFYPVPL-N-STNGLDTSVYG -GSVRHVMKAGFE ... -GNEKWVIGFSAMGSKPSGFMNRNVSNAGYMIGTWEP-GGEFKPET E-T TKEIECPDLVRIG EKDILIYSITS TNSVLFSMGELKE GKLNVEK AQGG-VWECPGLVKLPL-DSG -NSTKWVITSGLNPG -GPPGTVGSGTQYFVGEFDG-T-TFTPDADTVYPGNST-Y-YGNQYECPGLIEVPIEN-S...
  • 17
  • 521
  • 0

Xem thêm