electron hole pair exciton multiplication in quantum dots
Báo cáo hóa học: " Electron States and Light Absorption in Strongly Oblate and Strongly Prolate Ellipsoidal Quantum Dots in Presence of Electrical and Magnetic Fields" pot
... the electron hole interaction energy Thus, the problem is reduced to analytical determination of the energy separate expressions for electron and hole (as for non-interacting particles) The quantum ... respectively As in the SOEQD case, in the strong SQ regime we neglect the Coulomb interaction between the electron and hole The shape of QD depicted in the Fig 1b makes possible the particle motion in the ... are growing when the magnetic field intensity is increased This is conditioned by growth of the magnetic quantization contribution into the CC energy increase Inter level distance is increased...
- 8
- 246
- 0
Báo cáo hóa học: " Effective harvesting, detection, and conversion of IR radiation due to quantum dots with built-in charge" docx
... 6:21 Sablon KA, Mitin V, Sergeev A, Little JW, Vagidov N, Reinhardt K, Olver KA: Nanoscale engineering: optimizing electron- hole kinetics of quantum dot solar cells In Proceedings of SPIE: April ... barriers around single dots in directions perpendicular and parallel to QD planes model adequately takes into account the main effects of doping on photoelectron kinetics Bipolar kinetics: solar ... enough to minimize the strain The obtained structures were doped in two different ways: with intra-dot doping (devices B44 and B52) and with inter-dot doping (devices B45 and B53) In devices...
- 13
- 416
- 0
Báo cáo hóa học: " CdTe quantum dots with daunorubicin induce apoptosis of multidrug-resistant human hepatoma HepG2/ADM cells: in vitro and in vivo evaluation" pptx
... cultured in the cell culture medium containing μg/ mL adriamycin (Sigma) Both cell lines were maintained in RPMI-1640 medium containing 10% FCS, 100 U/ml of penicillin, and 100 μg/ml of streptomycin ... from the Institute of Hematology of Tianjin, Chinese Academy of Medical Sciences (Tianjin, China) To develop the drugresistant cell line (HepG2/ADM), adriamycin was added to HepG2 cells in a stepwise ... fixed in 100% methanol for 10 Cell monolayers were blocked in 5% BSA in PBS for 45 and incubated for h at room temperature with P-gp antibodies (Invitrogen, Beijing, China), followed by incubation...
- 11
- 383
- 0
Báo cáo hóa học: " Spin effects in InAs self-assembled quantum dots" pot
... self-assembled quantum dots Phys Rev B 2000, 62:13595 Vdovin EE, Levin A, Patanè A, Eaves L, Main PC, Khanin YN, Dubrovskii YV, Henini M, Hill G: Imaging the electron wave function in self-assembled quantum ... emission are in anti-phase with each other The observed reduction of contact emission and increase of QD emission in low bias can be explained by the reduction of holes recombining in GaAs contact ... Bennett CH, DiVincenzo P: Quantum information and computation Nature 2000, 404:247 Patane A, Levin A, Polimeni A, Eaves L, Main PC, Henini M, Hill G: Carrier thermalization within a disordered...
- 5
- 337
- 0
Báo cáo hóa học: " The Study of Quantum Interference in Metallic Photonic Crystals Doped with Four-Level Quantum Dots" pot
... Controlling spontaneous emission by using quantum optics would lead to several interesting effects, such as optical gain enhancement [20] and photoluminescence enhancement [21], optical switching ... [22, 23], quantum information processing [24, 25] and electromagnetically induced transparency [26] QI in a three- or multi-level atomic system can arise from the superposition of SEs when electron ... J.N Winn, R.D Meade, Photonic Crystals: Molding the Flow of Light (Princeton University Press, Princeton, 1995) C.M Soukoulis, Photonic Crystals and Light Localization in the 21st Century (Springer,...
- 5
- 478
- 0
Báo cáo hóa học: " Subcellular Localization of Thiol-Capped CdTe Quantum Dots in Living Cells" potx
... fluorescence intensity was much stronger at a later time Figure shows that the fluorescence intensity increased almost linearly during the incubation period from 30 to 55 min, demonstrating a gradual increase ... obtained from the Cell Bank of Shanghai Science Academy were seeded onto a glass cover slip placed in a culture dish containing DMEM-H medium with 10% fetal bovine serum, 100 lg mL-1 streptomycin ... color at an early time (30 min), indicating there were no QDs in these lysosomes; while at a later time (55 min), most lysosomes showed a yellow color (a color representing the mixed fluorescence...
- 7
- 227
- 0
Báo cáo hóa học: " Effects of Shape and Strain Distribution of Quantum Dots on Optical Transition in the Quantum Dot Infrared " doc
... to describe inter-atomic forces by using bond stretching and bending The role of strain (for three different shapes) in determining the bound levels is analyzed in detail Considering three different ... was grown on semi-insulating GaAs (001) substrates by using the solid-source molecular beam epitaxy (MBE) Five layers of nominally 3.0 momolayer (ML) InAs (quantum dots) were inserted between ... K is shown in Fig A main peak corresponding to the quantum dot ground state transitions is centered at 1.058 eV and a small broad shoulder due to smaller quantum dots or InAs wetting layer appears...
- 6
- 380
- 0
Báo cáo hóa học: " Are quantum dots ready for in vivo imaging in human subjects?" docx
... translate QDs for use in clinical applications such as in vivo imaging in human subjects Modeling studies have revealed that two spectral windows exist for QD imaging in living subjects, one at ... exhibited high affinity integrin avb3 specific binding in cell culture and ex vivo In vivo NIR fluorescence (NIRF) imaging was carried out on athymic nude mice bearing subcutaneous integrin avb3-positive ... in vivo targeted imaging using QDs, as extravasation is not required to observe tumor signal Arginine–glycine–aspartic acid (RGD; potent integrin avb3 antagonist) containing peptides were conjugated...
- 17
- 377
- 0
Báo cáo hóa học: " Excitonic Transitions and Off-resonant Optical Limiting in CdS Quantum Dots Stabilized in a Synthetic Glue Matrix" pptx
... technique is used in the present work for probing the electronic transitions in CdS quantum dots and correlating the observed data with the theoretical transitions obtained from a noninteracting particle ... observed in PAS Using NIP model for spherical quantum dots, the first few transitions are calculated and labeled as T1, T2 etc as shown in Table In this analysis, the difference between electron and hole ... limiting behavior The nonlinearity is probed using the z-scan technique Optical limiting can be due to a variety of nonlinear optical processes such as self focusing, self defocusing, nonlinear...
- 8
- 464
- 0
Báo cáo hóa học: " Influence of GaAs Substrate Orientation on InAs Quantum Dots: Surface Morphology, Critical Thickness, and Optical Properties" docx
... demonstrates the *12 meV exciton binding energy in these dots Due to the fact that the excitons in the WL easily interacted with the phonon and quenched, the integrated PL intensity of the 123 612 ... illustrate less strain relaxation for high index surfaces [19] The inhibition of strain relaxation inside the islands, by increasing the island internal energy term, should determine a delay in the 3D ... resulting edges of the QD During the SK growth of InAs 123 QDs, the main driving force forming islands is the strain relaxation, which permits relief of part of the strain induced by the lattice mismatch...
- 5
- 284
- 0
Báo cáo hóa học: " Whispering gallery modes in photoluminescence and Raman spectra of a spherical microcavity with CdTe quantum dots: anti-Stokes emission and interference effects" ppt
... 1), allowing a higher Q factor to be achieved in this spectral region Gaining a better insight into these experimental findings, we have studied spectra of CdTe/PS microspheres using low intensity ... be distinguished in the spectral region between them To gain more insight into the WGM structure in the microcavity we carried out a fast Fourier analysis, which makes it possible to investigate ... certainly highly efficient having an intensity comparable to the Stokes PL as seen from Fig We found that the integrated intensity of ASPL has an almost linear dependence on the excitation intensity...
- 6
- 329
- 0
FINGERPRINTS IN THE OPTICAL AND TRANSPORT PROPERTIES OF QUANTUM DOTS ppt
... Single Molecules in Self-Organized InP/GaInP Quantum Dots Alexander M Mintairov, James L Merz and Steven A Blundell Chapter InAs Quantum Dots in Symmetric InGaAs/GaAs Quantum Wells 153 Tetyana V Torchynska ... potential confinement by using higher indium composition in the dots a spectral width of 230nm was predicted in the In0 .9Ga0.1As/GaAs quantum dot system (Sun & Ding, 1999) In general, such inhomogeneous ... corresponding maximum continuous-wave output power was 0.65mW Spectral broadening using height engineered InAs/GaAs quantum dots Tuning the emission properties of QDs assemblies by in- situ annealing...
- 478
- 231
- 0
báo cáo khoa học: "Quantum dots – a versatile tool in plant science?" pdf
... digoxigenin-11-dUTP or biotin-16-dUTP FISH was carried out according to [20] For combined probing of rDNA and non-coding satellite DNA, in situ hybridisation was performed using 20 ng of digoxigenin-labeled ... enlarged quantum dots are shown in square inset Michalet X, Pinaud FF, Bentolila LA, Tsay JM, Doose S, Li JJ, Sundaresan G, Wu AM, Gambhir SS, Weiss S: Quantum dots for live cells, in vivo imaging, ... previously demonstrated in similar applications [2] To improve the performance of quantum dots in in situ hybridisation the following strategies were tested: (1) instead of fixation in an ethanol : acetic...
- 5
- 657
- 0
báo cáo khoa học: " Intein-mediated site-specific conjugation of Quantum Dots to proteins in vivo" pdf
... streptavidincoated QDs (4-10 streptavidin molecules (53 kD each)/ QD giving 16-40 biotin binding sites implying 16-40 conjugated PH-GFP protein molecules per QD) resulting in a significant increase in ... Akt-PH-EGFP via intein mediated protein splicing In vivo conjugation of QD's to Akt-PH-EGFP via intein mediated protein splicing (a) Schematic representation of site-specific intein-mediated conjugation ... using 2% cysteine-HCl, pH 7.8, then maintained in 0.1 × Marcc's Modified Ringer's (0.1 × MMR) Microinjections were performed in 4% Ficoll in 0.33 × MMR The embryos were injected with RNA and Intein...
- 9
- 203
- 0
báo cáo khoa học: "Optical characterization of colloidal CdSe quantum dots in endothelial progenitor cells" pptx
... probably modifications to the quantum confinement of electrons and holes in the CdSe QD are interactions between surface atoms and lipids and proteins (mostly interacting with Cd atoms) as well ... effects in QDs, electron states in the conduction band (hole states in the valence band) become quantized as Ec0, Ec1 etc (Ev0, Ev1 etc), where Ec0 and Ev0 denote the ground electron and hole state, ... i.e., Ec0 in Fig 7, in the conduction band and the ground hole state (Ev0) in the valence band is 1.988 eV, corresponding to the emission wavelength of 625 nm Because of the quantum confinement...
- 8
- 216
- 0
báo cáo khoa học: "The impact of CdSe/ZnS Quantum Dots in cells of Medicago sativa in suspension culture" pps
... sativa line M699, seeds being kindly provided by Diego Rubiales (IAS-CSIC, Spain) Well-developed petioles from 25 day old in vitro germinated M699 seedlings were used as explants for callus induction ... cell viability, mainly in cases where cells were isolated They also showed that some cells in aggregates maintain a certain degree of viability Quantum dot uptake M sativa cells internalized mercaptopropanoic ... selenide (CdSe) core and a zinc sulphide (ZnS) shell and whose excitons (excited electron- holepairs) are confined in all three dimensions, giving rise to characteristic fluorescent properties QDs are...
- 14
- 460
- 0
báo cáo khoa học: "Split-Inteins for Simultaneous, site-specific conjugation of Quantum Dots to multiple protein targets In vivo" pptx
... peptide (DnaE IC-Biotin) and biotinylated N-terminus DnaB mini-intein peptide (Biotin-DnaB IN) The 47 amino acid peptide sequence of the C-terminus DnaE intein peptide (DnaE IC-Biotin): MVKVIGRRSLGVQRIFDIGLPQDHNFLLANGAIAANCFDYKDDDDK(Ahx-Biotin)G ... conferring genetic mobility to Page of 14 the intein [35] During intein evolution however, some inteins lost sequence continuity, such as the DnaE split intein, and as a result they exist in two ... residue at the C-terminus of the intein to form succinimide [26], leading to excision of the intein and ligation of the exteins Inteins have been widely used for in vitro protein semi-synthesis...
- 14
- 290
- 0
Báo cáo khoa hoc:" Folic acid modified gelatine coated quantum dots as potential reagents for in vitro cancer diagnostics" pdf
... characterization DB participated in conceiving the biological testing and interpreting the data YKG conceived the study, participated in its design and coordination and helped in writing the manuscript All ... Pharmaceutical Science, Trinity College Dublin Author details School of Chemistry, Trinity College Dublin, Dublin 2, Ireland 2School of Pharmacy and Pharmacology, Trinity College Dublin, Dublin 2, Ireland ... ImageJ software An Olympus FV1000 Point-Scanning Confocal Microscope was used to examine the cells after staining with QDs and counter-staining with DAPI or Calcein AM Sequential acquisition was...
- 7
- 297
- 0
Plasmon exciton interaction in gold nanostructure and quantum dot conjugate and its applications in biosensing
... growing interest on interactions between SPs and electromagnetic fields breeds a fast expanding discipline in the past decades named plasmonics4, attracting a wide spectrum of scientists including ... formation of bound electron- hole pairs or excitons Interactions between excitons and SPs occur when metal and QD are in close proximity Usually this interaction can be divided into two opposite ... between binding sites on a living cell membrane based on plasmon -exciton energy transfer15 The distance between the aptamer and antibody binding sites in the membrane protein PTK7 was obtained from...
- 137
- 278
- 0
Multiphoton absorption and multiphoton excited photoluminescence in transition metal doped znsezns quantum dots
... confining the electrons and holes in regions smaller than their natural delocalization length in the bulk This enhancement is also called quantum confinement effect, which was discovered by Jain ... Bell Labs in 1983 [1.8] and was termed as Quantum Dot” by Mark Reed at Yale University [1.9] In bulk semiconductor, an electron and a hole can easily form an electron- hole pair (or exciton) , ... He interpreted his experimental results as direct DonorAcceptor recombination involving CuZn and Cu-X centers combined with indirect recombination via excited states of these centers Doping introduced...
- 191
- 265
- 0
Tìm thêm: xác định các mục tiêu của chương trình khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo gắn với các giáo trình cụ thể tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng 9 tr 25