0

cao thủ học đường lord of study tập 4 p3

Báo cáo khoa học: Selective inhibition of ADAMTS-1, -4 and -5 by catechin gallate esters ppt

Báo cáo khoa học: Selective inhibition of ADAMTS-1, -4 and -5 by catechin gallate esters ppt

Báo cáo khoa học

... this larger body of evidence [43 ].TIMP-3 has been shown to be a potent inhibitor of ADAMTS -4 and -5 [44 ,45 ]. We therefore assayed ourFig. 2. SDS/PAGE and Western blotting of aggrecan core protein ... 13230 V1EVSEPDN 12A374XGS 4 200 G 148 1RGTXD 6V1EVSEP 1170 G1667LGSVEL 4 A374RGSV 2V1EVSEP 1130 A1772GEGPSGI 20rhADAMTS-5280 A374XGSVIL 9V1EVSEPDN 5200 G 148 1RGTIDI 3A374RGSVXL 1170 G1667LGSVEL ... (pmol)rhADAMTS-1280–230 V1EVSEPDN 45 200 V1EVSEPXN 6G 148 1RXTXD 6170 G1667LGSVEL 4 V1EVSEPD 2A374RGSVIL 1130 A1772GEGPSGI 8V1EVSE 3G 148 1RXTXD 1100 L1872GQRPXV 3G 148 1RXTXD 1rhADAMTS -4 280 V1EVSEPDN 13230...
  • 10
  • 416
  • 0
Báo cáo khoa học: Translational incorporation of L-3,4-dihydroxyphenylalanine into proteins docx

Báo cáo khoa học: Translational incorporation of L-3,4-dihydroxyphenylalanine into proteins docx

Báo cáo khoa học

... 2162.9 2162.0 22–39 TFDDKAPETVKNFLDYCR 946 .4 946 .4 33–39 NFLD#CR930 .4 930 .4 930 .4 33–39 NFLDYCR 141 3.7 141 3.7 40 –50 EGF#NNTIFHR1397.5 1396.7 1397.7 40 –50 EGFYNNTIFHR1781.6 1781.6 1781.9 51–67 ... 70– 84 ATKEPIKNEANNGLK1326.5 1326.6 1326.7 73– 84 EPIKNEANNGLK719 .4 719 .4 719 .4 88– 94 GTLAMAR5285.0 5283 .4 95– 142 TQAPHSATAQFFINVVDNDFLNFS-GESLQGWG#CVFAEVVDGMDVVDK5269.0 5269.0 5267 .4 95– 142 ... TQAPHSATAQFFINVVDNDFLNFS-GESLQGWGYCVFAEVVDGMDVVDK561 .4 561 .4 560.3 145 –150 GVATGR 241 3.7 241 4.0 241 3.2 151–172 SGMHQDVPKEDVIIESVTVSENTranslational incorporation of DOPA into proteins K. Ozawa et al.3166...
  • 10
  • 386
  • 0
 Báo cáo y học:

Báo cáo y học: "The epidemiology of medical emergency contacts outside hospitals in Norway - a prospective population based study"

Y học thưởng thức

... 1 2 74 100 4 897 100NACA-score0-1 38 10 44 6 95 15 87 9 101 19 86 7 45 1 102-3 163 43 46 5 59 41 8 65 631 65 326 62 747 63 2 750 61 4- 6 117 30 265 34 96 15 243 25 83 16 318 27 1 122 257 64 17 ... mission*A06InconclusiveproblemA10Chest painA 34/ 35AccidentsAll othercategoriesTotaln% n % n% n% n% n% n%Patients 41 0 8 8 64 18 707 14 1 098 22 565 12 1 280 26 4 9 24 100Male0-9 years 11 6 44 24 24 14 2 1 15 8 85 47 181 10010-29 ... day0800-1529 170 41 367 43 275 39 393 36 256 45 43 9 34 1 897 391530-2259 137 34 292 34 266 38 368 34 211 38 44 7 35 1 721 352300-0759 103 25 199 23 160 23 332 30 97 17 388 31 1 279 26Total 41 0 100 858...
  • 9
  • 784
  • 0
Báo cáo y học:

Báo cáo y học: "A prospective observational study of the relationship of critical illness associated hyperglycaemia in medical ICU patients and subsequent development of type 2 diabetes"

Y học thưởng thức

... Metab 2008, 93: 244 7- 245 3. 46 . International Expert Committee report on the role of the A1C assay in the diagnosis of diabetes. Diabetes Care 2009, 32:1327-13 34. 47 . Proceedings of the 4th International ... 0.038Triglycerides (mmol/l) 1 .4 (0.9 to 4. 5) 1 .4 (0.9 to 4. 2) 1.3 (0.9 to 4. 5) P = 0.106Cholesterol (umol/l) 4. 5 (2.1 to 7.7) 4. 8 (2.0 to 9.7) 4. 9 (2.1 to 8.0) P = 0. 146 Glucose levelsc6 .4 (2.7 to 23.5) ... 48 106all patients 193 398New IFG or IGT- sepsisa18 18 2.1 (95% CI 1.3 to 4. 1)- ACSb19 17 2.6 (95% CI 1 .4 to 4. 6)- other diagnoses 10 14 1.9 (95% CI 0.9 to 3.9)all patients 47 ( 24. 4%)...
  • 8
  • 656
  • 1
Báo cáo y học:

Báo cáo y học: "A Comparative Effectiveness Study of Bone Density Changes in Women Over 40 Following Three Bone Health Plans Containing Variations of the Same Novel Plant-sourced Calcium"

Y học thưởng thức

... the 6-year rate of bone loss among premenopausal and perimenopausal women. Osteoporos Int 20 04; 15 :43 9 -44 6. 47 . Chapurlat RD, Gamero P, Sornay-Rendu E, et al. Longitudinal study of bone loss ... in study design, prep-aration of the Informed Consent and computerizing of all study data. Keith PL also aided in study design, preparation of the Informed Consent, aided in en-rollment of ... Int 2000;11 :49 3 -49 8. 48 . Guthrie JR, Ebeling PR, Hopper JL, et al. A prospective study of bone loss in menopausal Australian-born women. Osteopo-ros Int 1998;8(3):282-290. 49 . Sowers M,...
  • 12
  • 663
  • 0
Báo cáo khóa học: Conformational changes of b-lactoglobulin in sodium bis(2-ethylhexyl) sulfosuccinate reverse micelles A fluorescence and CD study docx

Báo cáo khóa học: Conformational changes of b-lactoglobulin in sodium bis(2-ethylhexyl) sulfosuccinate reverse micelles A fluorescence and CD study docx

Báo cáo khoa học

... 2003, revised 4 December 2003,accepted 22 December 2003)Eur. J. Biochem. 271, 7 34 744 (20 04) Ó FEBS 20 04 doi:10.1111/j. 143 2-1033.20 04. 03977.x dislocation of local quenchers. The inset of Fig. 3 ... BSE crisis. Science278, 245 –251. 14. Frapin, D., Dufour, E. & Haertle´, T. (1993) Probing the fattyacid binding site of b-lactoglobulin. J. Protein Chem. 12 ,44 3– 44 9.15. Sawyer, L. & ... Costa, S.M.B. (2000) The location of trypto-phan, N-acetyltryptophan and a-chymotrypsin in reverse micelles of AOT: a fluorescence study. Photochem. Photobiol. 72, 44 4 45 0.20. Palazolo, G., Rodrı´quez,...
  • 11
  • 523
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "An Extensive Empirical Study of Collocation Extraction Methods" ppt

Báo cáo khoa học

... schemes, e.g Kita (19 94) or Evert (2001).A comprehensive study of statistical aspects of wordcooccurrences can be found in (Evert, 20 04) .In this paper we present a compendium of 84 methods for automatic ... status quo of anongoing research study of collocations –an essential linguistic phenomenon hav-ing a wide spectrum of applications inthe field of natural language processing.The core of the work ... University of Pennsylvania.K. Kita, Y. Kato, T. Omoto, and Y. Yano. 19 94. A comparative study of automatic extraction of collocations from corpora:Mutual information vs. cost criteria. Journal of Natural...
  • 6
  • 547
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "Serial Combination of Rules and Statistics: A Case Study in Czech Tagging" potx

Báo cáo khoa học

... 4. 72%Exp 3 95.19% 53 .49 % 95 .41 % 4. 57%Exp 4 95. 04% 53 .44 % 95.28% 4. 84% Exp 5 95.11% 53.82% 95. 34% 4. 70%Average 95.16% 53.36% 95.38% 4. 58%Table 5: F-measure-based evaluation of the combined tagger, ... (bucketing)Exp 1 95.23% 95. 34% Exp 2 94. 95% 95.13%Exp 3 95. 04% 95.19%Exp 4 94. 77% 95. 04% Exp 5 94. 86% 95.11%Average 94. 97% 95.16%Table 4: Evaluation of the HMM tagger, 5-fold cross-validationspecial ... applied) 28.97% 100.00% 44 .92%After application of the manually written rules 36 .43 % 99.66% 53.36%Table 1: Evaluation of rules alone, average on all 5 test setsno buckets 0 .43 71 0.5009 0.0600 0.0020bucket...
  • 8
  • 518
  • 0
Báo cáo Y học: Functional assignment of motifs conserved in b1,3-glycosyltransferases A mutagenesis study of murine UDP-galactose:b-N-acetylglucosamine b1,3-galactosyltransferase-I pptx

Báo cáo Y học: Functional assignment of motifs conserved in b1,3-glycosyltransferases A mutagenesis study of murine UDP-galactose:b-N-acetylglucosamine b1,3-galactosyltransferase-I pptx

Báo cáo khoa học

... 26 129D177A-D179A 541 94 76 40 60P233A-P234A 7135 102 115 33 66C236A 11 579 153 101 88 146 E264A 2589 108 93 22 67C271A 3286 128 99 65 141 C295A 41 2 156 82 93 1 34 W315A 143 0 166 112 12 66C326A ... Lactoseb-pNPSf9mock 335 132 75 12 135b3GalT-I 11 665 1 34 160 14 148 C73A 276 140 80 23 129I97A-R98A 989 166 265 13 64 W101 2571 94 76 40 54 F116A-L117A-L118A-G119A 42 0 158 133 73 76W162A 2073 108 166 15 125C167A ... architecture of b-glycosyltransferases: implications for mechanism of action. J. Bacteriol.177, 141 9± 142 4.28. Busch, C., Hofmann, F., Gerhard, R. & Aktories, K. (2000)Involvement of a conserved...
  • 7
  • 404
  • 0
Báo cáo khoa học: The use of recombinant protein and RNA interference approaches to study the reproductive functions of a gonad-stimulating hormone from the shrimp Metapenaeus ensis ppt

Báo cáo khoa học: The use of recombinant protein and RNA interference approaches to study the reproductive functions of a gonad-stimulating hormone from the shrimp Metapenaeus ensis ppt

Báo cáo khoa học

... analogousfunction. Some of these genes may be expressed in0 h 24 h 48 h 72 h 96 h 120 hMIH-Bβ-actin+-+-+-+-+-Ctr120967 248 240 Relative change in transcript level1008060 40 20120967 248 240 Time after ... expressionFunctional study of crustacean neuropeptide S. H K. Tiu and S M. Chan 43 94 FEBS Journal 2 74 (2007) 43 8 543 95 ê 2007 The Authors Journal compilation ê 2007 FEBS in the stimulation of gonad maturation. ... and S M. Chan Functional study of crustacean neuropeptideFEBS Journal 2 74 (2007) 43 8 543 95 ê 2007 The Authors Journal compilation ê 2007 FEBS 43 91 (20 lL) consisted of 10 mm Tris ⁄ HCl (pH 8.0),...
  • 11
  • 546
  • 0
Báo cáo khoa học: Combined use of selective inhibitors and fluorogenic substrates to study the specificity of somatic wild-type angiotensin-converting enzyme docx

Báo cáo khoa học: Combined use of selective inhibitors and fluorogenic substrates to study the specificity of somatic wild-type angiotensin-converting enzyme docx

Báo cáo khoa học

... Asn 642 Asn 642 Asn 642 Ser119 Ser119 Ser119 Glu719 Glu719 Glu719Ser4 94 Asn4 94 Asn4 94 Ala1092 Ala1092 Ser1092Val495 Val495 Val495 Asn1093 Asn1093 Ser1093Thr496 Thr496 Thr496 Val10 94 Val10 94 Val10 94 S1Â ... (12.8–15.2) 14. 0 (12.9– 14. 8)Km(lM) 45 .9 (37.852.9) 26.1 (19.933.6) 35.7 (26 .44 0.8)kcat Km(s)1ặlM) 0.06 0.53 0.39C-domain kcat(s)1) 19.1 (17.9–20.0) ND 4. 2 (37. 4. 7)Km(lM) 49 .5 (43 .1–53.3) ... ND 64. 6 (52 .4 77.1)kcat⁄ Km(s)1ặlM) 0.39 ND 0.06N+C kcat Km(s)1ặlM) 0 .45 0 .45 Somatic ACE kcat(s)1) 24. 7 (22.5–26.3) 14. 2 (13.6–15.8) 16.5 (15.1–17.7)Km(lM) 46 .9 (38 .4 52.5)...
  • 10
  • 499
  • 1
Báo cáo khoa học:

Báo cáo khoa học: "Beyond NomBank: A Study of Implicit Arguments for Nominal Predicates" doc

Báo cáo khoa học

... Technologies] reported a net loss of $889,000 on sales of $23 .4 million.(10) That compared with an operating [p loss] of [arg1$1.9 million] on sales of $27 .4 millionin the year-earlier period.In ... 160 35.0 1.1 2.0 54. 6 1.6fund 109 8.7 0 .4 2.0 21.6 0.9loss 1 04 33.2 1.3 2.0 46 .9 1.9plan 102 30.9 1.2 1.8 49 .3 2.0investment 102 15.7 0.5 2.0 33.3 1.0cost 101 26.2 1.1 2.3 47 .5 1.9bid 88 ... and p.15 Number of left siblings of p.16 Whether p is the head of its parent node.17 Number of right siblings of p.Table 2: Features for determining whether c fills iargn of predicate p. For...
  • 10
  • 402
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "Automatic Adaptation of Annotation Standards: Chinese Word Segmentation and POS Tagging – A Case Study" potx

Báo cáo khoa học

... u(C0) = 0 ◦ α = bT (C−2)T (C−1)T (C0)T (C1)T (C2) = 44 444 ◦ α = bTable 2: An example of basic features and guidefeatures of standard-adaptation for word segmen-tation. Suppose we are ... en-gineering.526 Proceedings of the 47 th Annual Meeting of the ACL and the 4th IJCNLP of the AFNLP, pages 522–530,Suntec, Singapore, 2-7 August 2009.c2009 ACL and AFNLPAutomatic Adaptation of Annotation ... latter problem often implies the former,as in our case study. To test the efficacy of our method we chooseChinese word segmentation and part -of- speechtagging, where the problem of incompatible...
  • 9
  • 404
  • 0
Báo cáo Y học: Differential scanning calorimetric study of myosin subfragment 1 with tryptic cleavage at the N-terminal region of the heavy chain pdf

Báo cáo Y học: Differential scanning calorimetric study of myosin subfragment 1 with tryptic cleavage at the N-terminal region of the heavy chain pdf

Báo cáo khoa học

... Structure 4, 969–987. 43 . Reizes, O., Barylko, B., Li, C., Suădnof, T.C. & Albanesi, J.P.(19 94) Domain structure of a mammalian myosin Ib. Proc. NatlAcad. Sci. USA 91, 6 349 –6353. 44 . Greene, ... of nucleotides [44 ], andthis weak binding is realized mainly through electrostaticinteraction of loop 2 with the negatively charged N-terminalpart of actin [38 40 ]. Thus, the interaction of ... preselectedsites on proteins: the stretch of residues 633– 642 of the myosinheavy chain is part of the actin-binding site. Proc. Natl Acad. Sci.USA 85, 747 1– 747 5. 41 . Ponomarev, M., Furch, M., Knetsch,...
  • 11
  • 432
  • 0
Báo cáo khoa học: Identification of a novel thyroid hormone-sulfating cytosolic sulfotransferase, SULT1 ST5, from zebrafish Molecular cloning, expression, characterization and ontogenic study ppt

Báo cáo khoa học: Identification of a novel thyroid hormone-sulfating cytosolic sulfotransferase, SULT1 ST5, from zebrafish Molecular cloning, expression, characterization and ontogenic study ppt

Báo cáo khoa học

... KmL-T328.8 ± 2.5 38.7 ± 5.9 0. 74 D-T335.6 ± 3 .4 27.7 ± 2.8 1.29L-rT3 14. 6 ± 0.6 17.1 ± 0.7 0.85L-T 4 6.6 ± 0.6 44 .5 ± 6.7 0.15L-Thyronine 41 .9 ± 2.3 1 14. 2 ± 12.8 0.37b-Naphthol 32.3 ± ... (L-rT3) 11.62 0 .48 Genistein 12.71 ± 0.17L-Thyroxine (L-T 4 ) 4. 31 ± 0. 14 b-Naphthol 12.26 ± 0.1617b-Estradiol NDbCatechin 11 .47 ± 0 .41 Estrone ND Caffeic acid 9.95 ± 0.17 4- Androstene-3,17-dione ... zebrafish SULTs, the newly clonedzebrafish SULT1 ST5 displays 44 , 45 , 43 , and 46 %Fig. 1. Alignment of the deduced amino acid sequences of SULT1 ST5 and four known zebrafish SULT1 STs. Two ‘signature...
  • 10
  • 336
  • 0

Xem thêm