brauer jianhong wu modeling sars west nile virus pandemic influenza and other emerging infectious diseases a canadian team apos s adventure
Modulation of west nile virus capsid protein and viral RNA interaction through phosphorylation 1
... positive-sense and negative-sense viral RNA from purified virions Bhuvana for her assistance and technical advise on kinase activators and inhibitors I thank all the members of the Flavivirus Laboratory: ... encephalitis virus and Murray Valley virus The damage caused to the meninges, brain parenchyma and spinal cord had caused poliovirus-like flaccid paralysis in some infected patients (Sejvar et al., ... Orthomyxoviridae (Tchatalbachev et al., 2001) In all these examples, RNA encapsidation signal contains complex secondary confirmation such as stem loops and bulges Analysis of 5’ and 3’UTR of flavivirus...
- 44
- 304
- 0
Modulation of west nile virus capsid protein and viral RNA interaction through phosphorylation 2
... Primer Name His-C F His-C- R Sense RNA UTR F Sense RNA UTR R Sense RNA UTR F Sense RNA UTR R Sense RNA UTR+C F Sense RNA UTR+C R A- sense RNA UTR F A- sense RNA UTR R A- sense RNA UTR F A- sense RNA UTR ... cytopathic effects were apparent (usually days post transfection) The virus was processed and propagated as | Materials and methods 36 described in Section 2.2.3 and 2.2.2, respectively Mutagenesis ... RNA 11R RNA 12F RNA 12R A- sense RNA 1F A- sense RNA 1R A- sense RNA 12R | Materials and methods Purpose Cloning of C protein Synthesize sense 3’ UTR viral RNA Synthesize sense 5’ UTR viral RNA Synthesize...
- 51
- 244
- 0
Modulation of west nile virus capsid protein and viral RNA interaction through phosphorylation 3
... assay was developed to study C protein and WNV RNA interaction in vivo In this assay, nascent viral RNA was fluorescently labelled in infected cells instead and at the same viral C protein was ... cells were sites of viral RNA synthesis and at later time points (18 hr and 24 hr) viral RNA had begun to diffuse into the cytoplasm Because the RNA labelling kit also labels host RNA, fluorescently ... WNV RNA fragments Equal amounts of His-C protein was loaded into each lane and subjected to SDS-PAGE and transferred onto a nitrocellulose membrane The membrane was subsequently probed with each...
- 27
- 165
- 0
Modulation of west nile virus capsid protein and viral RNA interaction through phosphorylation 4
... and SDS-PAGE analyses (Lanes and 8) Markers are in Lanes and on the Western blot and SDSPAGE, respectively λ-phosphatase is indicated by a black arrowhead (Lane 7) The antiphosphoserine antibody ... λ-phosphatase and subjected to both Western blot and SDS-PAGE analysis At the same time bacteria expressed histidine-tagged West Nile Virus (WNV) capsid (C) protein is also subjected to Western blot and ... The amount of sense RNA is set to an arbitrary value of and the amount of anti-sense RNA is expressed as a fraction of the sense RNA The ratio of positive- to negative-stand RNA in WT virus- infected...
- 47
- 214
- 0
Modulation of west nile virus capsid protein and viral RNA interaction through phosphorylation 5
... replication Experiments with Potato virus X also suggested that phosphorylation may destabilise C protein since encapsidated viral RNA was made available for translation when its coat protein (analogous ... presence of detergents like SDS This showed that the dimers and oligomers were very stable and resistant to boiling and SDS Since oligomerization is spontaneous, it would be reasonable to suggest ... diagram is divided into two general phases of the virus replication – early phase and late phase The early phase is anytime up to 12 hr post-infection and the late phase is anytime after 12 hr post-infection...
- 34
- 185
- 0
Báo cáo khoa học: NMR study of complexes between low molecular mass inhibitors and the West Nile virus NS2B–NS3 protease ppt
... protein synthesis Synthesis was performed using mL reaction mixtures for sets 1–4 and mL for set Set was the only reaction containing 15N-glutamate This set was prepared using 100 mm potassium succinate ... protease– helicase suggests that the protease domain assists the binding of nucleotides to the helicase and may also participate in RNA unwinding [3] Crystal structures of WNV NS2B–NS3pro have been ... signals appeared in an intense cluster of peaks at a chemical shift characteristic of a random coil peptide chain Structural variability of these residues has initially been suggested by the absence...
- 12
- 451
- 0
Norwalk virus, west nile virus, hanta virus
... http://www.cbsnews.com/stories/2007/06/11/health/main2911164.shtml Are vaccines safe? Testing safety and effectiveness - Laboratory testing : Cell models Animal models - Human trials: Phase I Phase II Phase III Post-licensure surveillance Are vaccines ... manufacture How are vaccines made? Challenges for vaccine development Are vaccines safe? Testing safety and effectiveness: The case of Thimerosal (mercury preservative) in vaccines and autism - Andrew ... proximity of humans, pigs, birds: - H5N1: 50% lethal, no human-human transmission yet Antigenic shift and flu pandemics Shift - Reassortment: viral gene segments randomly reassociate -Achieved by...
- 56
- 1,269
- 0
Báo cáo sinh học: " The Israeli strain IS-98-ST1 of West Nile virus as viral model for West Nile encephalitis in the Old World" pdf
... 77:2578-2586 Xiao SY, Guzman H, Zhang H, Travassos da Rosa AP, Tesh RB: West Nile virus infection in the golden hamster (Mesocricetus auratus): a model for West Nile encephalitis Emerg Infect Dis 2001, ... WNV antigens (using anti-WNV mouse immune serum and a FITC-conjugated secondary antibody, green staining) and neuronal specific enolase (using a rabbit polyclonal antiserum and an anti-rabbit ... data showing a massive infection of brain structures such as brain stem, hippocampus and cortex of WNV-infected animals [12] and human patients[5] The high neuropathogenicity of IS-98-ST1 isolated...
- 5
- 403
- 0
Báo cáo sinh học: " Peptide inhibitors of dengue virus and West Nile virus infectivity" pot
... disparate viruses, including arenaviruses, coronaviruses, filoviruses, orthomyxoviruses, paramyxoviruses and retroviruses, encode similar proteins that together are classified as class I fusion proteins ... 22:3563-3574 Sabchareon A, Lang J, Chanthavanich P, Yoksan S, Forrat R, Attanath P, Sirivichayakul C, Pengsaa K, Pojjaroen-Anant C, Chokejindachai W, Jagsudee A, Saluzzo JF, Bhamarapravati N: Safety and ... AVLGDTAWDFGSVGGVFTSVGKAVHQVFGGA AVMGDTAWDFSSAGGFFTSVGKGIHTVFGSA AVLGDTAWDFGSIGGVFTSIGKALHQVFGGA AALGDTAWDFGSIGGVFNSIGKAVHQVFGGA TVIGEHAWDFGSAGGFLSSIGKAVHTVLGGA TVLGEHAWDFGSTGGFLSSIGKALHTVLGGA TVVGEHAWDFGSVGGMLSSVGKALHTAFGAA...
- 10
- 392
- 0
Báo cáo sinh học: " Actively replicating West Nile virus is resistant to cytoplasmic delivery of siRNA" ppt
... gggcagttctgggtgaagt ctacggtcaccctgagtga gaggagcaagtctgctatgc gtgtcaaggaggatcgact gacggtgatgtgattgggct gcagcaagaggttacattt gttgaagtcatcacgaagt gtggaagtcatcacgaagc caacgagatgggttggcta gaagaacgctgtagtggat ggacgcaccttgggagaggt ... gaagaacgctgtagtggat ggacgcaccttgggagaggt ggtcaacagcaatgcagct cagcaatgcagctttgggt gaagcagagccatttggtt gggaaaggacccaaagtca gagagatatgaagacacaac siRNA were generated against 19–21 nucleotide sequences corresponding ... expression and possibly as an innate defense against RNA viruses [16] RNAi uses double stranded RNA (dsRNA) to target and degrade sequencespecific single-stranded RNA The cytoplasmic ribonuclease DICER...
- 13
- 340
- 0
Báo cáo hóa học: " In vitro effects of selenium deficiency on West Nile virus replication and cytopathogenicity" ppt
... control, Se- and Se+ Vero (A) and SK-N-SH (B) cells and GPx1 enzyme activity was measured at days 3, and 10 post-induction of Se deficiency by using the cGPx1 assay kit Data are reported as mean ± SD ... progression of viral diseases, and both, clinical and in vitro studies to assess Se supplementation as an adjuvant therapy for HIV-infected patients are encouraging [36,37] An inverse correlation ... Vero and SK-N-SH cells for 10–12 days Se-deficient cells were maintained for 10 days and passaged every days using serum-free trypsin-EDTA solution and the GPx1 enzyme activity was measured at days...
- 13
- 409
- 0
Báo cáo hóa học: " Detection of seroconversion to West Nile virus, Usutu virus and Sindbis virus in UK sentinel chickens" doc
... findings of others that although mosquitoes are important vectors in disease transmission, other modes of transmission and persistence may also be important in the transmission and circulation ... Pham SM, Zaki S, Lanciotti RS, Lance-Parker SE, Diaz Granados CA, Winquist AG, Perlino CA, Wiersma S, Hillyer KL, Goodman JL, Marfin AA, Chamberland ME, Petersen LR: Transmission of West Nile virus ... addition we also included USUV and SINV in this analysis because it extended the range of viruses analysed and also served as a form of internal control for virus- specificity The results of plaque reduction...
- 6
- 359
- 0
báo cáo hóa học:" Peptide inhibitors of dengue virus and West Nile virus infectivity" doc
... disparate viruses, including arenaviruses, coronaviruses, filoviruses, orthomyxoviruses, paramyxoviruses and retroviruses, encode similar proteins that together are classified as class I fusion proteins ... 22:3563-3574 Sabchareon A, Lang J, Chanthavanich P, Yoksan S, Forrat R, Attanath P, Sirivichayakul C, Pengsaa K, Pojjaroen-Anant C, Chokejindachai W, Jagsudee A, Saluzzo JF, Bhamarapravati N: Safety and ... AVLGDTAWDFGSVGGVFTSVGKAVHQVFGGA AVMGDTAWDFSSAGGFFTSVGKGIHTVFGSA AVLGDTAWDFGSIGGVFTSIGKALHQVFGGA AALGDTAWDFGSIGGVFNSIGKAVHQVFGGA TVIGEHAWDFGSAGGFLSSIGKAVHTVLGGA TVLGEHAWDFGSTGGFLSSIGKALHTVLGGA TVVGEHAWDFGSVGGMLSSVGKALHTAFGAA...
- 10
- 363
- 0
báo cáo hóa học:" Actively replicating West Nile virus is resistant to cytoplasmic delivery of siRNA" pptx
... gggcagttctgggtgaagt ctacggtcaccctgagtga gaggagcaagtctgctatgc gtgtcaaggaggatcgact gacggtgatgtgattgggct gcagcaagaggttacattt gttgaagtcatcacgaagt gtggaagtcatcacgaagc caacgagatgggttggcta gaagaacgctgtagtggat ggacgcaccttgggagaggt ... gaagaacgctgtagtggat ggacgcaccttgggagaggt ggtcaacagcaatgcagct cagcaatgcagctttgggt gaagcagagccatttggtt gggaaaggacccaaagtca gagagatatgaagacacaac siRNA were generated against 19–21 nucleotide sequences corresponding ... expression and possibly as an innate defense against RNA viruses [16] RNAi uses double stranded RNA (dsRNA) to target and degrade sequencespecific single-stranded RNA The cytoplasmic ribonuclease DICER...
- 13
- 260
- 0
Báo cáo y học: "Ocular Manifestations of West Nile Virus Infection" doc
... multifocal chorioretinitis can help establish an early diagnosis of the disease while serologic testing is pending Therefore, an ocular examination, including ophthalmoscopy and FA in selected cases, ... Med Sci 2009, 115 vicides…) and personal protection against mosquito bites (repellants, window screens, protective clothing,…) Vaccination, a long term solution, is still in the research phase ... United States Annu Rev Med 2006;57:181-94 Khairallah M, Ben Yahia S, Ladjimi A, et al Chorioretinal involvement in patients with West Nile virus infection Ophthalmology 2004;111:2065-70 Garg S, Jampol...
- 2
- 473
- 0
báo cáo khoa học: "Prognosis of West Nile virus associated acute flaccid paralysis: a case series" pdf
... the results As a sensitivity analysis, the mean PCS and MCS scores were recalculated without Patient number six s data and the scores were as follows: the mean PCS score at baseline was 30 [SD, ... the CSF He was admitted to the hospital for observation and further examination Serum IgM was positive for West Nile virus and an EMG was consistent with West Nile virus acute flaccid paralysis ... was elevated at 1.06 g/L He was admitted to the hospital for observation and further examination Serum IgM was positive for West Nile virus and a diagnosis of West Nile virus acute flaccid paralysis...
- 6
- 287
- 0
báo cáo khoa học: "A nano-view of West Nile virus-induced cellular changes during infection" pps
... Virus West Nile (Sarafend) virus, a kind gift from Professor E G Westaway, Sir Albert Sakzewski Virus Research Laboratory, Queensland, Australia), was propagated in Vero cells throughout this study ... images that we used for comparison, and made such comparisons more meaningful At such an early stage of research, confirmations and corroboration from other more established microscopy forms are ... plasma membrane in the West Nile virus- infected Vero cells (Fig 2) The AFM can image the virus- induced changes in the host cell as well as minute structures (50 nm) such as West Nile virus particles...
- 7
- 188
- 0
Báo cáo y học: " The natural history of West Nile virus infection presenting with West Nile virus meningoencephalitis in a man with a prolonged illness: a case report" doc
... at that time was positive (acute and convalescent phase) A brain MRI scan (Figure 1C) obtained on day 21 revealed resolving inflammatory changes in the basal ganglia and thalamus Six weeks later ... WNV encephalitis Other viral illnesses such as Japanese encephalitis virus and St Louis encephalitis virus can show similar findings; thus brain MRI cannot be the sole diagnostic modality for ... 1B) showed decreased edema in the basal ganglia and thalamus as compared to the prior MRI scans On day 19, he was fully oriented, and his mental status appeared to have returned to baseline His...
- 4
- 310
- 0
Báo cáo y học: " First serological evidence of West Nile virus in human rural populations of Gabon" pdf
... outbreaks or even isolated cases could be due to the circulation of less virulent WNV strains Clinical cases may be misdiagnosed and attributed to a similar disease such as malaria or another arbovirosis ... Niedrig M, Sonnenberg K, Steinhagen K, Paweska JT: Comparison of ELISA and immunoassays for measurement of IgG and IgM antibody to West Nile virus in human sera against virus neutralisation J Virol ... BJ: Transmission dynamics and changing epidemiology of West Nile virus Anim Health Res Rev 2008, 9:71-86 Mathiot CC, Georges AJ, Deubel V: Comparative analysis of West Nile virus strains isolated...
- 3
- 314
- 0
Báo cáo y học: "A VLP-based vaccine targeting domain III of the West Nile virus E protein protects from lethal infection in mice" pptx
... Haagmans BL, Fouchier RAM, Osterhaus ADME, Rimmelzwaan GF: A recombinant influenza A expressing domain III of West Nile virus induces protective immune responses against influenza and West Nile ... 3000 CA Rotterdam, The Netherlands, 3Latvian Biomedical Research and Study Centre, Ratsupites iela 1, Riga, LV 1067, Latvia, 4AO Foundation, Clavadelerstrasse 8, 7270 Davos Platz, Switzerland and ... (Spectrum Laboratories) The conjugate vaccine was analyzed by SDS-PAGE followed by Coomassie Blue staining or by Western Blot using AP205- and His-tag- specific antisera The molecular masses of the...
- 9
- 272
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25