b crystal structure of co l8 2 pf6 2 1¾ch3cn
Metal Complexes of 4′-Substituted-2,2′:6′,2″-Terpyridines in Supramolecular Chemistry
... data of [Co( L8) 2] [PF6 ]2 1¾CH3CN [Co( L )2] [PF6 ]2 300 and 14 304 Appendix IV: Crystal data of L and 2, 7-di (2- hydroxyethoxy)naphthalene 306 Appendix V: Crystal data of [{Ru(L11) }2] [PF6 ]2 4⁄5(C2H5)2O·2CH3CN, ... [{Ru(L11) }2] [PF6 ]2 4⁄5(C2H5)2O·2CH3CN, 14 [{Fe(L )}] [PF6 ]2 (C2H5)2O·½CH3CN and [{Fe(L15)}] [PF6 ]2 CH3CN 14 26 6 7.5 Stereochemical properties of the chiral complex [{Fe(L )}] [PF6 ]2 273 7.6 Conclusion 27 9 ... [Co( L7 )2] [PF6 ]2 and [Co( L9 )2] [PF6 ]2 143 4.4 Mass spectrometric characterisation 150 4.5 Absorption spectroscopic characterisation 1 52 4.6 Crystal structures of [Co( L )2] [PF6 ]2 and [Co( L )2] [PF6 ]2 1¾CH3CN...
- 341
- 258
- 0
Tài liệu Báo cáo khoa học: The crystal structure of human a-amino-b-carboxymuconatee-semialdehyde decarboxylase in complex with 1,3-dihydroxyacetonephosphate suggests a regulatory link between NAD synthesis and glycolysis ppt
... 23 24 25 26 27 28 29 30 31 32 33 34 35 a-amino -b- carboxymuconate-e-semialdehyde decarboxylase (ACMSD) J Biol Chem 27 7, 351 62 35167 Tanabe A, Egashira Y, Fukuoka SI, Shibata K & Sanada H (20 02) ... Apoptosis induced by niacin-related FEBS Journal 27 6 (20 09) 6615–6 623 ª 20 09 The Authors Journal compilation ª 20 09 FEBS 6 621 Crystal structure of human ACMSD 10 11 12 13 14 15 16 17 18 19 20 S Garavaglia ... decarboxylase J Am Chem Soc 129 , 927 8– 927 9 Fukuoka SI, Ishiguro K, Yanagihara K, Tanabe A, Egashira Y, Sanada H & Shibata K (20 02) Identification and expression of a cDNA encoding human 6 622 21 22 ...
- 9
- 796
- 0
Tài liệu Báo cáo khoa học: The crystal structure of coenzyme B12-dependent glycerol dehydratase in complex with cobalamin and propane-1,2-diol pptx
... 20 21 22 23 24 25 26 27 28 29 Structure of B1 2- dependent glycerol dehydratase (Eur J Biochem 26 9) 4493 coenzyme B1 2: X-ray structure of diol dehydratase-adeninylpentylcobalamin complex Structure ... dehydrataseÆcobalamin Ó FEBS 20 02 Structure of B1 2- dependent glycerol dehydratase (Eur J Biochem 26 9) 4491 Fig Structures of the active site and the cobalamin-binding site (A) Stereo drawing of the ... is covered by the corrin ring of cobalamin that is bound on the interface of the a and b subunits Two a subunits form dimer a2 to which two b and two c subunits are bound separately This structure...
- 11
- 602
- 0
Báo cáo khoa học: Crystal structure of basic 7S globulin, a xyloglucanspecific endo-b-1,4-glucanase inhibitor protein-like protein from soybean lacking inhibitory activity against endo-b-glucanase doc
... Yoshizawa et al Structure of Bg7S, a XEGIP-like protein of soybean Structured digital abstract l Bg7S binds to Bg7S by x-ray crystallography (View interaction) l Bg7S binds to Bg7S by cosedimentation ... Journal 27 8 (20 11) 1944–1954 ª 20 11 The Authors Journal compilation ª 20 11 FEBS 1945 Structure of Bg7S, a XEGIP-like protein of soybean T Yoshizawa et al Fig Structure of Bg7S from soybean (A) ... supposedly stabilize the three-dimen- Structure of Bg7S, a XEGIP-like protein of soybean sional structure of Bg7S The Cys209–Cys418 bond seems to be significant for stabilization in particular, because...
- 11
- 524
- 0
Báo cáo khoa học: The crystal structure of a xyloglucan-specific endo-b-1,4glucanase from Geotrichum sp. M128 xyloglucanase reveals a key amino acid residue for substrate specificity potx
... ideality (bond length) (A) Root mean square deviations from ideality (angle) (°) Value 1.0000 20 2. 5 (2. 59 2. 5) 0.096 (0.199) 26 7 8 42 43 425 98.4 (93 .2) 6 .2 (6.0) 17.9 (8.6) 20 2. 5 (2. 56 2. 5) 0 .23 6 ... 4), because of its strict specificity for glycosidic bonds of the unbranched Glc residue By contrast, the FEBS Journal 27 6 (20 09) 5094–5100 ª 20 09 The Authors Journal compilation ª 20 09 FEBS 5097 ... structures Nature 355, 4 72 475 21 Emsley P & Cowtan K (20 04) Coot: model-building tools for molecular graphics Acta Crystallogr D 60, 21 26 21 32 22 Potterton L, McNicholas S, Krissinel E, Gruber...
- 7
- 361
- 0
Báo cáo khoa học: Crystal structure of a cold-adapted class C b-lactamase potx
... quality of protein structures J Appl Crystallogr 26 , 28 3 29 1 51 Lambert C, Leonard N, De Bolle X & Depiereux E (20 02) ESyPred3D: prediction of protein 3D structures Bioinformatics 18, 125 0– 125 6 52 ... (1991) Comparison of the sequences of class A beta-lactamases and of the secondary structure elements of penicillin-recognizing proteins Antimicrob Agents Chemother 35, 22 94– 23 01 D’Amico S, Sohier ... A & Zavodszky P (20 01) A better enzyme to cope with cold Comparative flexibility studies on psychrotrophic, mesophilic, and thermophilic IPMDHs J Biol Chem 27 6, 28 121 – 28 125 20 Kim S-Y, Hwang...
- 11
- 341
- 0
Crystal structure of arabidopsis thaliana cyclophilin 38 (atcyp38 2
... YDGMEIQRSD TEKTRTVPLE YKAQVVIPFN VFWLLKESEL NEDFLADLKV YKIAG 437 1 12 1 42 1 72 2 02 2 32 2 62 2 92 322 3 52 3 82 4 12 Figure 28 The sequence of AtCyP38 (83-437) The native methionine residues are highlighted ... Cytochrome b5 62 is about 10% identical and aligns with an R.M.S.D of 1.73 for 83 residues, Fig 32 A B Figure 32 Structure overlap for the helical bundle of AtCyP38 with (A) PsbQ and (B) cytochrome b5 62 ... MIEKLEAGMQDMLKIVEDRKRDAVAPKQKEILKYVGGIEEDMVDGFPYE 180 190 21 0 20 0 β3 22 0 β4 α6 VPEEYRNMPLLKGRASVDMKVKIKDNPNIEDCVFRIVLDGYNAPVTAGN 23 0 25 0 24 0 26 0 27 0 β5 α6 FVDLVERHFYDGMEIQRSDGFVVQTGDPEGPAEGFIDPSTEKTRTVPLE 28 0 300 29 0 310 320 β6 IMVTGEKTPFYGSTLEELGLYKAQVVIPFNAFGTMAMAREEFENDSGSS...
- 36
- 182
- 0
Structural basis of protein stability at poly extreme crystal structure of amya at 1 6 a resolution 2
... Table 2. 3 Table 2. 3 Coordinating atoms of calcium and distances Calcium No Interacting Atoms ASP 44 OD1 ASP 46 OD1 ASP 48 OD1 ILE 50 O ASP 52 OD2 WAT 27 Distance in Å 2. 47 2. 49 2. 50 2. 45 2. 48 2. 70 ... negatively charged residues Asp 128 , Asp 224 , Glu260, and Asp330 that are known to be involved in substrate binding and catalysis (Abad et al, 20 02) 53 Table 2. 4 Exposure of charged residues on various ... experiments 2. 3 RESULTS 2. 3.1 Overview of AmyA structure AmyA consists of a single polypeptide chain of 488 residues and comprises a total of 18 α-helices and 20 β-strands The overall fold of AmyA consists...
- 33
- 290
- 0
Tài liệu Báo cáo khoa học: Crystal structure of an ascomycete fungal laccase from Thielavia arenaria – common structural features of asco-laccases ppt
... 0 .2 61 ± 2. 7 ± 0.1 FEBS Journal 27 8 (20 11) 22 83 22 95 ª 20 11 The Authors Journal compilation ª 20 11 FEBS J P Kallio et al Crystal structure of a Thielavia arenaria laccase Fig (A) The crystal structure ... Journal 27 8 (20 11) 22 83 22 95 ª 20 11 The Authors Journal compilation ª 20 11 FEBS 22 85 Crystal structure of a Thielavia arenaria laccase J P Kallio et al thermostability of the enzyme [34] On the basis ... increases A typical feature of basidiomycete laccases is FEBS Journal 27 8 (20 11) 22 83 22 95 ª 20 11 The Authors Journal compilation ª 20 11 FEBS 22 89 Crystal structure of a Thielavia arenaria laccase...
- 13
- 888
- 0
Tài liệu Báo cáo khoa học: Crystal structure of importin-a bound to a peptide bearing the nuclear localisation signal from chloride intracellular channel protein 4 ppt
... Waals’ contacts between the Tyr205 side chain and importin-a (Table 2) The numbers of contacts are comparable with those of the basic residues at P2 (Lys203: 31 contacts), P3 (Lys204: 20 contacts) ... NLS binding J Biol Chem 27 5, 21 218 21 223 Kobe B (1999) Autoinhibition by an internal nuclear localization signal revealed by the crystal structure of mammalian importin alpha Nat Struct Biol ... MR, Corbett AH & Hodel AE (20 01) Dissection of a nuclear localization signal J Biol Chem 27 6, 1317– 1 325 Fontes MR, Teh T & Kobe B (20 00) Structural basis of recognition of monopartite and bipartite...
- 14
- 741
- 0
Tài liệu Báo cáo khoa học: Crystal structure of the cambialistic superoxide dismutase from Aeropyrum pernix K1 – insights into the enzyme mechanism and stability pdf
... (1.38–1.35) 1 529 91 (10838) 18.8 (23 .9) ⁄ 20 .3 (25 .4) 0.008 1.170 6 823 18 734 49.75–1.48 (1. 52 1.48) 113539 (7965) 22 .6 (29 .5) ⁄ 25 .6 ( 32. 7) 0.0 12 1.3 82 6855 10 417 24 .5 39.1 14.8 27 .6 10.1 21 .0 28 .4 16.0 ... (NE2) B WAT H169 (NE2) D165 (OD2) H79 (NE2) WAT H31 (NE2) C WAT D165 (OD2) H169 (NE2) H79 (NE2) H31 (NE2) D E FEBS Journal 27 8 (20 11) 598–609 ª 20 10 The Authors Journal compilation ª 20 10 FEBS 603 ... Number of intrasubunit ion pairs ⁄ residue Number of intersubunit ion pairs ⁄ tetramer Number of intersubunit ion pairs ⁄ residue SsoSOD 0.033 0. 024 24 0. 028 24 0. 029 ApSOD TthSOD 14 0.066 22 ...
- 12
- 762
- 0
Tài liệu Báo cáo khoa học: Crystal structure of Klebsiella sp. ASR1 phytase suggests substrate binding to a preformed active site that meets the requirements of a plant rhizosphere enzyme doc
... FEBS Journal 27 7 (20 10) 128 4– 129 6 ª 20 10 The Authors Journal compilation ª 20 10 FEBS 128 7 Crystal structure of Klebsiella phytase PhyK A Tyr249 Thr2 92 K Bohm et al ¨ Tyr249 Thr2 92 Asp291 Asp291 ... domain FEBS Journal 27 7 (20 10) 128 4– 129 6 ª 20 10 The Authors Journal compilation ª 20 10 FEBS 128 5 Crystal structure of Klebsiella phytase PhyK A K Bohm et al ¨ B Fig Crystal structure of Klebsiella ... involved in substrate recognition are well conserved among species FEBS Journal 27 7 (20 10) 128 4– 129 6 ª 20 10 The Authors Journal compilation ª 20 10 FEBS K Bohm et al ¨ Crystal structure of Klebsiella...
- 13
- 766
- 0
Tài liệu Báo cáo khoa học: Crystal structure of the catalytic domain of DESC1, a new member of the type II transmembrane serine proteinase family pptx
... (1997) Analy- Crystal structure of the catalytic domain of DESC1 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 sis of tissue factor and tissue factor pathway inhibitor expression in human colorectal ... inhibited with benzamidine, concentrated to mgÆmL)1 and subjected to FEBS Journal 27 4 (20 07) 21 48 21 60 ª 20 07 Max-Planck-Insitute of Biochemistry Journal compilation ª 20 07 FEBS 21 57 Crystal structure ... region of known TTSP structures Whereas in the stem regions of FEBS Journal 27 4 (20 07) 21 48 21 60 ª 20 07 Max-Planck-Insitute of Biochemistry Journal compilation ª 20 07 FEBS 21 55 Crystal structure of...
- 13
- 588
- 0
Tài liệu Báo cáo khoa học: Crystal structure of the BcZBP, a zinc-binding protein from Bacillus cereus doc
... FEBS Journal 27 4 (20 07) 3044–3054 ª 20 07 The Authors Journal compilation ª 20 07 FEBS 3045 Crystal structure of BcZBP from B cereus V E Fadouloglou et al A B Fig Structure of the BcZBP dimer (A) ... compilation ª 20 07 FEBS V E Fadouloglou et al Crystal structure of BcZBP from B cereus Fig Model of the BcZBP–GlcNAc complex Stereoview of the energy minimized putative BcZBP–GlcNAc complex A slice ... Journal 27 4 (20 07) 3044–3054 ª 20 07 The Authors Journal compilation ª 20 07 FEBS 3047 Crystal structure of BcZBP from B cereus V E Fadouloglou et al Table Deacetylase activity of the BcZBP protein...
- 11
- 710
- 0
Tài liệu Báo cáo khoa học: ˚ The 1.8 A crystal structure of a proteinase K-like enzyme from a psychrotroph Serratia species docx
... [19 ,24 ,25 ]) SPRK from the psychrotrophic Serratia sp is not found to be considerable less stable than PRK [18], but VPRK is [26 ,27 ] This could possibly in part be related to the number of salt bridges ... (CI2; PDB 1lw6, 1tm1 and 2sni [29 –31]) or eglinC (PDB 1sbn [ 32] ) and subtilisin Carlsberg in complex with eglinC (PDB 1cse [33]), ovomucoid turkey inhibitor (OMTKY3; PDB 1r0r [34]) or the double-headed ... loop of chymotrypsin inhibitor II (CI2) in complex with subtilisin BPN (cyan, PDB 2sni), the inhibitor fragment of lactoferrin in complex with PRK (green, PDB 1bjr), a hepta-peptide in complex...
- 11
- 551
- 0
Tài liệu Báo cáo khoa học: Crystal structure of a subtilisin-like serine proteinase from a psychrotrophic Vibrio species reveals structural aspects of cold adaptation docx
... E236–R2 52 E255–K267 D260–R185 D274–R14 3. 02 2.83 2. 81 2. 92 3 .28 ˚ A ˚ A ˚ A ˚ A ˚ A D187–R 12 (E27–87 E48–R80 E50–R 52 D98–K94 D1 12 R147 D117–R 121 D184–R188 D260–R 12 1THM 2. 77 4.65 3.93 2. 95 2. 75 ... 2. 75 2. 76 2. 94 3. 02 3. 02 ˚ A ˚ A)a ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A D57–R1 02 D60–R1 02 D188–K17 E28–K95 D 124 –K153 D188–R270 D201–R249 E253–R249 D257–R270 D257–K275 2. 97 3.00 3.91 2. 79 3 .20 2. 81 3.41 2. 98 ... (20 03) The structure of a ˚ cold-adapted family xylanase at 1.3 A resolution FEBS Journal 27 2 (20 05) 8 32 845 ª 20 05 FEBS ´ ´ J Arnorsdottir et al 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 Structural...
- 14
- 597
- 0
Tài liệu Báo cáo khoa học: Crystal structure of Trypanosoma cruzi glyceraldehyde-3-phosphate dehydrogenase complexed with an analogue of 1,3-bisphospho-D-glyceric acid Selective inhibition by structure-based design docx
... Number of unique reflections Resolution range Overall completeness Overall Rmerge I/rI Redundancy 88 606 33 568 ˚ 8.0 2. 75 Aa 92. 4% ( 92. 8% )b 9 .2% (30.4% )b 11.8 (3.9 )b 2. 6 (2. 3 )b ˚ Dataset was collected ... 350 800 65 20 00 150 900 20 0 700 HOP Inhibition and site-directed mutagenesis of T brucei gGAPDH In the absence of a 3D structure of a complex of T brucei gGAPDH with an analogue of 1,3-BPGA, we ... differences may be responsible for the extended/bent conformation of inhibitors inside the active site: (a) substitution of Ser247 in T cruzi gGAPDH by Ala246 in T brucei gGAPDH; (b) different conformations...
- 13
- 588
- 0
Tài liệu Báo cáo khoa học: Crystal structure of thiamindiphosphate-dependent indolepyruvate decarboxylase from Enterobacter cloacae, an enzyme involved in the biosynthesis of the plant hormone indole-3-acetic acid doc
... decarboxylase involved in 23 20 A Schutz et al (Eur J Biochem 27 0) ¨ 10 11 12 13 13a 14 15 16 17 18 19 20 21 22 23 24 25 26 indole-3-acetic acid synthesis in Erwiniaherbicola Appl Environ Microbiol ... site-directed mutagenesis study of L1 12, I4 72, I476, E473, and N4 82 Eur J Biochem 25 7, 538–546 Ó FEBS 20 03 3D structure of indolepyruvate decarboxylase (Eur J Biochem 27 0) 23 21 44 Bringer-Meyer, S., Schimz, ... size of the substrate binding cavity in ZmPDC (Tyr290, Trp387 and Trp5 42) , are shown in red Ó FEBS 20 03 3D structure of indolepyruvate decarboxylase (Eur J Biochem 27 0) 23 19 Fig Comparison of...
- 10
- 557
- 0
Báo cáo khoa học: Crystal structure of salt-tolerant glutaminase from Micrococcus luteus K-3 in the presence and absence of its product L-glutamate and its activator Tris pdf
... in coordinate by Luzzati (A) N BL-6A T AR-NW12A G AR-NW12A TG BL-6A 2. 3 10.9 (2. 2) 2. 5 11.0 (2. 1) 2. 6 9.1 (2. 8) 2. 4 8.7 (1.8) 189 811 52 671 100 (99.9) 149 20 7 40 451 98.4 (98.0) 125 111 35 920 ... SpoIIAA, in complex with SpoIIAB, contained 11 interface residues (21 , 23 -25 , FEBS Journal 27 7 (20 10) 738–748 ª 20 09 The Authors Journal compilation ª 20 09 FEBS 739 Crystal structure of salt-tolerant ... 52. 8 117.45 141. 62 75.15 90 104.0 90 58.0 118.36 141 .20 76. 12 90 105.4 90 41.0 F 19.9 2. 3 52 579 0 .24 7 0 .29 1 TG 19.9 2. 5 40 379 0 .21 7 0 .25 8 N 19.9 2. 6 35 873 0 .27 1 0.309 N 19.9 2. 4 46 741 0 .22 2...
- 11
- 521
- 0
Báo cáo khoa học: The crystal structure of NlpI A prokaryotic tetratricopeptide repeat protein with a globular fold potx
... 79, 80, 83 2. 5 Helix 11 21 2, 21 6 16 Helix 12 237, 24 0, 24 4 Helix 13 25 5, 25 8, 25 9 ,26 1, 26 2, 26 4, 26 6 16 Helix 14 27 1, 27 5, 27 8 2. 45 Total 38 FEBS Journal 27 2 (20 05) 166–179 ª 20 04 FEBS C G M Wilson ... interactions between elements of primary FEBS Journal 27 2 (20 05) 166–179 ª 20 04 FEBS structure, and include a hydrogen bond between the backbone carbonyl of Asn263 and the backbone amide of Leu34 ... only structures of FEBS Journal 27 2 (20 05) 166–179 ª 20 04 FEBS Crystal structure of NlpI natural TPRs in the PDB (13 TPR-containing coordinate sets) consist of nonglobular, extended arrays of helices...
- 14
- 433
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 động cơ điện không đồng bộ một pha phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25