addins for the ide
Tài liệu Báo cáo khoa học: What makes biochemical networks tick? A graphical tool for the identification of oscillophores ppt
Ngày tải lên :
19/02/2014, 16:20
... each other). The value (the sign) of a cycle is
the product of the values (the signs) of its steps. The sign o f
the magnitude of a Ôminus combined autoinfluence path
of order pÕ equal those of the ... follows. They
indicate the influence the (production rate of the) substance
on the right may experience through reaction r,fromthe
substance o n the left, which is a substrate of that reaction r if
the ... antiparallel arrows). The sign of that element
therefore depends on the both the sign and the magnitudes
of these influen ce paths (see below). If all its i nfluence paths
are positive, the Jacobian matrix...
- 11
- 638
- 0
Báo cáo khoa học: "A Unified Statistical Model for the Identification of English BaseNP" pptx
Ngày tải lên :
08/03/2014, 05:20
... totally correct for the 2nd step.
This provides an ideal upper bound for the
system. The reason why we choose N=4 for the
N-best POS tagging can be explained in Figure
4, which shows how the precision ... morning"
Figure 3: the transformed form of the path with dash line for the second pass processing
2.4 The statistical parameter
training
In this work, the training and testing data were
derived from the 25 ... benefit from baseNP information.
Whether or not the baseNP information can
improve the precision of POS tagging in our
approach is determined by the identifier
assignment of the baseNP rules when...
- 8
- 482
- 0
Báo cáo khoa học: Identification of the structural determinant responsible for the phosphorylation of G-protein activated potassium channel 1 by cAMP-dependent protein kinase pdf
Ngày tải lên :
07/03/2014, 00:20
... several
efforts undertaken to identify the responsible structural
determinant on the GIRK1 subunit [17,23], the exact
location still remains unknown. The present study
aimed to obtain information ... distal
part is unique for GIRK1 among the Kir3.x isoforms.
Further truncations of the C-terminus revealed a 49
amino acid stretch (amino acids 362–411) that was the
most prominent target for phosphorylation ... acids
were mutated. The data obtained in the present study provide information
about the structural determinants that are responsible for protein kinase A
phosphorylation and the regulation of...
- 9
- 403
- 0
Báo cáo khoa học: Identification of crucial residues for the antibacterial activity of the proline-rich peptide, pyrrhocoricin pot
Ngày tải lên :
08/03/2014, 10:20
... FEHKRKELEQVCNPIISGLYQGAGGPGPGGFGA
a
The fluorescein-label was directly coupled to the amino-termini of the peptides.
b
The fluorescein-label was directly coupled to the amino-
termini of the peptides, except for the Pyrr-10-20-K(Fl) ... that the TAGADA C-terminal
hexapeptide fragment of the E. coli sequence (where these
minor mutations are found) is not needed for the binding,
the S. typhimurium peptide was not synthesized. The ... detected for the
binding fragment of the responsive strain E. coli, but not
for the nonbinding fragment of the unresponsive strain
S. aureus (Fig. 6). If any consequence for the nature of the
Fig....
- 12
- 442
- 0
Báo cáo khoa học: "Semantic Retrieval for the Accurate Identification of Relational Concepts in Massive Textbases" ppt
Ngày tải lên :
17/03/2014, 04:20
... clarifies
the effect of using the term ontology. Comparison
of X-2 and X-3 shows the effect of the event ex-
pression ontology. The results for X-3 indicate
the maximum performance of the current ... to be applied on the fly.
Another difficulty is that target information must
be formalized beforehand and each system is de-
signed for a specific task. For instance, an IE
system for protein-protein ... which
point to the IDs of the argument phrases. For ex-
ample, in Figure 6, the <word> tag for “exclude”
has the attributes arg1="1" and arg2="24",
which denote the IDs of the...
- 8
- 523
- 0
THE GUIDE TO CASHING SAVINGS BONDS - (Formerly known as the Identification Guide for Cashing United States Savings Bonds) pptx
Ngày tải lên :
22/03/2014, 20:20
... must obtain one for
the child before the bond can
be cashed on the child’s
behalf.)
Is the address on the bond the child’s Go to the Identification tab. Have the customer enter the
current address? ... description on the document to the customer,
• confirm the name on the identification and the name on the bond are the same, and
• make sure the signature on the document and on the bond compare ... institution?
Does the identifier know the customer by Go to the next question. Go to the Document tab.
the name on the bond?
Is the source and duration of the Go to the Document tab.
acquaintance between the...
- 32
- 424
- 0
THE ATTRACTIONS OF RISK-BASED REGULATION: ACCOUNTING FOR THE EMERGENCE OF RISK IDEAS IN REGULATION docx
Ngày tải lên :
23/03/2014, 00:20
... and the US
during the late 1980s/ 1990s. These techniques are part of the changes associated with the
NPM and they form the basis of much risk-based regulation. Their concern is to appraise the ... 4- 5).
These components are important in two regards. First, for the pressures they put on regulators
in terms of how they conducted their own operations, and second for the pressures they put ... case identified the disadvantages of the risk management tools it
discussed. Essentially these centre on the simplification inherent in the tools and the
consequent dangers of not recognising the...
- 21
- 533
- 0
Support to the identification of potential risks for the environment and human health arising from hydrocarbons operations involving hydraulic fracturing in Europe doc
Ngày tải lên :
23/03/2014, 00:20
... fracturing, and pre-perforated liners are not widely used in the US on-shore.
Anecdotal evidence suggests that in-place perforation provides more accuracy for placing
the perforations. Perforation is ... perforations are present at the appropriate point, fracturing fluid is pumped into the
well at high pressure.
The proppant is forced into the fractures by the pressured water, and holds the ... casing
extends to the top of the hydrocarbon-bearing formation. Cement is pumped between the
intermediate casing and the intervening formations to isolate the well bore from the
surrounding...
- 292
- 586
- 0
Báo cáo " A combination of the identification algorithm and the modal superposition method for feedback active control of incomplete measured systems " doc
Ngày tải lên :
28/03/2014, 13:20
... controlled by the identification algorithm. The
numerical simulations are taken when the sensor is placed at the distances L/4, L/2 and L from the
base. In Fig 3, the shapes of the 1st mode, the 3rd ... subinterval T
k
ended,
the information known can be used only in the next subinterval T
k+1
to calculate u
[k+1]
(t). Using the
delayed information, the control force u
c
acting on the significant ... some first modes is
identified with a time delay and with a small error depending on the locations of the sensors. Then
the control forces will be generated to balance the identified excitations....
- 8
- 359
- 0
Báo cáo " A combination of the identification algorithm and the modal superposition method for feedback active control of incomplete measured systems" doc
Ngày tải lên :
28/03/2014, 13:20
... subinterval T
k
ended,
the information known can be used only in the next subinterval T
k+1
to calculate u
[k+1]
(t). Using the
delayed information, the control force u
c
acting on the significant ... term. The
magnitude of the error term depends on the number and the locations of the sensors. The numerical
simulation is applied to a base excited cantilever beam to illustrate the algorithm. The ... The effects of the
time delay and the location of sensor are considered.
Acknowledgements. The paper is based on the talk given at the Conference on Mathematics,
Mechanics, and Informatics, Hanoi,...
- 8
- 416
- 0
Báo cáo khoa học: Identification of alternative promoter usage for the matrix Gla protein gene Evidence for differential expression during early development in Xenopus laevis doc
Ngày tải lên :
30/03/2014, 16:20
... to the hypothesis of a second
functional promoter for the XlMGP gene. Luc reporter
constructs and subsequent deletion mutant analysis
confirmed this hypothesis and provided clear evidence
for the ... our data identifies for the first time,
the presence of alternative promoter usage for the
MGP gene and provides clear evidence for differential
expression of this gene during the very early stages ... on the dorsal side and by red arrows on the ventral side. The embryos hybridized with the sense probe show no staining (a, a¢,
c, c¢,e,e¢).
N. Conceic¸a˜o et al. Alternative promoter usage for...
- 10
- 457
- 0
The idealist guide to nonprofit careers for first time job seekers
Ngày tải lên :
05/04/2014, 01:31
... of
other talents and skills to the board
that will strengthen the organization.
The Idealist Guide to Nonprofit Careers for First-time Job Seekers • Chapter Five • 91
Idealist.org
Consider ... for their incredible support.
The Idealist Guide to Nonprofit Careers for First-time Job Seekers • Chapter Four • 67
Idealist.org
What kind of information you are seeking (information about the ... that the
federal government does the best job of helping people.
The Idealist Guide to
Nonprofit Careers
for First-time Job Seekers
by
Meg Busse
with
Steven Pascal-Joiner
The Idealist Guide...
- 240
- 332
- 0
a world for us the case for phenomenalistic idealism dec 2008
Ngày tải lên :
10/06/2014, 21:33
... (character and location). Rather,
the item and, in their concretely realized form, these aspects are before S’s
The Problem of Perception 35
momentary stages, together with the fact that this latter ... and if the only additional relevant factors involve nothing further
about the subject’s psychological condition at the relevant time. The only
way in which the adoption of the sense-datum theory ... the strength of
the radiation and the resulting degree of the effect on phenomenal content.
It is surely clear that, somewhere in the middle, cases would occur where the
question of whether the...
- 265
- 241
- 0
university of texas press heraldry for the dead memory identity and the engraved stone plaques of neolithic iberia sep 2008
Ngày tải lên :
11/06/2014, 15:53
... one: they suggested that the two forms existed at the same time.
Like some prehistorians before them, the Leisners also noted the engraving styles
of the plaques and observed that some of the ... ESPRIT constitutes the empirical
basis for the ideas in this work. e University of Iowa Offi ce of the Vice President
for Research provided support for the preparation of this manuscript.
e ... infl uences in the
plaques. In contrast to many other scholars, they argued that the plaques with
purely geometric forms were the earliest in the sequence. eir designs refl ected
the symbolic...
- 233
- 221
- 0
báo cáo hóa học:" Identifying alemtuzumab as an anti-myeloid cell antiangiogenic therapy for the treatment of ovarian cancer" pdf
Ngày tải lên :
18/06/2014, 15:20
... legitimate therapeutic targets for solid
tumor therapy, we sought to determine the relationship of
VLC and Tie2
+
monocytes. Furthermore, we attempted to
identify an anti-VLC therapeutic for use ... crit-
ical role for these cells in tumorigenesis and indicate that
these cells may be novel therapeutic targets for solid
tumor therapy. Genetic manipulations to inhibit or elim-
inate these cells ... anti-CD52
therapy twice-weekly for three weeks. Therapy was then
discontinued and tumor growth was monitored for sev-
eral weeks. Therapy significantly restricted solid tumor
growth throughout the...
- 14
- 728
- 0
