a modular open source system for recognizing textual entailment
Báo cáo khoa học: "A Modular Open-Source System for Recognizing Textual Entailment" pot
... DepartmentBar-Ilan UniversityRamat-Gan 52900, Israeldagan@cs.biu.ac.ilAbstractThis paper introduces BIUTEE1, an open- source system for recognizing textual entail-ment. Its main advantages are its ability ... Open- Source System for Recognizing Textual Entailment Asher SternComputer Science DepartmentBar-Ilan UniversityRamat-Gan 52900, Israelastern7@gmail.comIdo DaganComputer Science DepartmentBar-Ilan ... encourage researchers to create andshare their textual- inference components. A good example from another research area is theMoses system for Statistical Machine Transla-tion (SMT) (Koehn et al.,...
- 6
- 414
- 0
Báo cáo khoa học: "An Open-Source Package for Recognizing Textual Entailment" pdf
... Malakasiotis and Ion Androutsopoulos2007. Learning Textual Entailment using SVMs andString Similarity Measures. Proc. of the ACL ’07Workshop on Textual Entailment and Paraphrasing.Ido Dagan ... regards the RTE Challenges, in the lastyears EDITS has been used to participate both inthe PASCAL/TAC RTE Campaigns for the En-glish language (Mehdad et al., 2009), and in theEVALITA RTE task ... H.Similarity algorithms are adapted to the ED-ITS distance framework by transforming measuresof the lexical/semantic similarity between T and Hinto distance measures. These algorithms are alsoadapted...
- 6
- 358
- 0
Tài liệu Báo cáo khoa học: "Types of Common-Sense Knowledge Needed for Recognizing Textual Entailment" ppt
... the ACL-PASCAL Workshop on Textual Entailment and Paraphrasing, RTE ’07, pages54–59, Morristown, NJ, USA. Association for Com-putational Linguistics.333#56 - ENTAILMENT T: (CNN) Nadya Suleman, ... An Elec-tronic Lexical Database. Bradford Books.R.V. Guha and D.B. Lenat. 1990. Cyc: a mid-term re-port. AI Magazine, 11(3).V. Vydiswaran M. Sammons and D. Roth. 2010. Asknot what textual ... not: A case study using functional relations. In EmpiricalMethods in Natural Language Processing.Dan Roth and Mark Sammons. 2007. Semantic and log-ical inference model for textual entailment. ...
- 6
- 512
- 0
Tài liệu Báo cáo khoa học: "A Logic-based Semantic Approach to Recognizing Textual Entailment" ppt
... 2006.c2006 Association for Computational Linguistics A Logic-based Semantic Approach to Recognizing Textual Entailment Marta Tatu and Dan MoldovanLanguage Computer CorporationRichardson, Texas, 75080United ... 71.89 66.66Table 3: RTE 2005 data results (accuracy, confidence-weighted score, and f-measure for the true class)Task COGEX COGEX LEXALIGN COMBINATIONacc ap f acc ap f acc ap f acc ap fIE 58.00 ... data. Itoutperforms the semantic systems on the 2005 QAtest data, but it has its limitations. The logic rep-resentations are generated from parse trees whichare not always accurate (86% accuracy)....
- 8
- 440
- 0
Tài liệu A Hybrid Neural Fuzzy System for Statistical Process Control docx
... work for various applications, data transformation is necessary to standardize the raw data into the value rangethat both neural network components can work with. Formulas for data transformation ... Tables 18.6 (a) and (b), to Acosta and Pignatiello’s(1996) EWMA chart which adopts Roberts’ (1959) EWMA for mean and Wortham’s and Heinrich’s(1972) EWMA for variance.To obtain a fair comparison, ... operations,etc. A QC can be mathematically defined as a random variable, which is a function that takes values from a population or distribution. Denote a QC as random variable x . If a population...
- 22
- 716
- 1
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... DNA poly-merase was purchased from Toyobo (Osaka, Japan). Emul-gen 911 was a gift from Kao Chemical (Tokyo, Japan).NADPH, NADH and NADP+were purchased fromOriental Yeast (Tokyo, Japan). a- Cyano-4-hydroxycinnamicacid ... Tmvalue of each protein at neutralpH. a Data from this study.bData from Griffin et al. [32].cData fromYano et al. [4].T. Mandai et al. Thermostable electron transport system FEBS Journal...
- 14
- 617
- 0
Tài liệu Báo cáo khoa học: "An Open Source Toolkit for Phrase-based and Syntax-based Machine Translation" docx
... {zhanghao1216,liqiangneu}@gmail.com Abstract We present a new open source toolkit for phrase-based and syntax-based machine translation. The toolkit supports several state-of-the-art ... Phrasal: A Toolkit for Statistical Machine Translation with Facilities for Extraction and Incorporation of Arbitrary Model Features. In Proc. of HLT/NAACL 2010 demonstration Session, pages ... Chris Callison-Burch, Chris Dyer, Sanjeev Khudanpur, Lane Schwartz, Wren Thornton, Jonathan Weese, and Omar Zaidan. 2009. Joshua: An Open Source Toolkit for Parsing-Based Machine Translation....
- 6
- 530
- 0
Tài liệu Báo cáo khoa học: "MemeTube: A Sentiment-based Audiovisual System for Analyzing and Displaying Microblog Messages" pdf
... We also integrate the sentiment-detection system with a real-time rule-based harmonic music and animation generator to display streams of messages in an audiovisual format. Conceptually, ... generating music melody au-tomatically based on detected sentiments, and (3) produce an animation of real-time piano playing for audiovisual display. Our MemeTube system can be accessed via: ... In recent years, a number of studies have inves-tigated integrating emotions and music in certain media applications. For example, Ishizuka and Onisawa (2006) generated variations of theme...
- 6
- 449
- 0
Báo cáo khoa học: "A Broad-Coverage Normalization System for Social Media Language" pot
... informal writing style and theconversational nature. The social text serves as a very valuable information source for many NLP ap-plications, such as the information extraction (Ritteret al., ... word-coverageacross all data sets and the broad word-coverage canbe successfully translated into message-level perfor-mance gain. We observe that the social media is anemotion-rich language, therefore ... word-coverage across all data sets (a 10% absolute increase compared to state-of-the-art); the broad word-coverage can alsosuccessfully translate into message-level per-formance gain, yielding 6% absolute...
- 10
- 845
- 0
Báo cáo khoa học: "Methods for Using Textual Entailment in Open-Domain Question Answering" doc
... paraphrases aregenerally assumed to contain information aboutthe same event, these approaches have generallyassumed that all of the available paraphrases for a given sentence will include at ... Fortieth Annual Meeting of theAssociation for Computational Linguistics (ACL),Philadelphia, PA.Dan Moldovan, Marius Pasca, Sanda Harabagiu, andMihai Surdeanu. 2002. Performance Issues and Er-ror ... Harabagiu, Dan Moldovan, Marius Pasca, RadaMihalcea, Mihai Surdeanu, Razvan Bunsecu, Rox-ana Girju, Vasile Rus, and Paul Morarescu. 2001.The Role of Lexico-Semantic Feedback in Open- Domain...
- 8
- 535
- 0
Báo cáo khoa học: "An Open Source Toolkit for Tree/Forest-Based Statistical Machine Translation" ppt
... Asiawuxianchao@gmail.com,takuya-matsuzaki@nii.ac.jp,jtsujii@microsoft.comAbstractWe describe Akamon, an open source toolkit for tree and forest-based statistical machinetranslation (Liu et al., 2006; ... Toolkit for Tree/Forest-Based Statistical Machine Translation∗Xianchao Wu†, Takuya Matsuzaki∗, Jun’ichi Tsujii‡†Baidu Inc.∗National Institute of Informatics‡Microsoft Research Asiawuxianchao@gmail.com,takuya-matsuzaki@nii.ac.jp,jtsujii@microsoft.comAbstractWe ... Normalized Kendall’s τ as proposed by(Isozaki et al., 201 0a) to automatically evaluate thetranslation between distant language pairs based onrank correlation coefficients and significantly penal-2Code...
- 6
- 347
- 0
Báo cáo khoa học: "The S-Space Package: An Open Source Package for Word Space Models" pdf
... Probabilis-tic Approaches to Natural Language, pages 61–65.AAAI Press.Zellig Harris. 1968. Mathematical Structures of Lan-guage. Wiley, New York.Mario Jarmasz and Stan Szpakowicz. 2003. Roget’sthesaurus ... models, which facilitates wordspace based applications.The package is written in Java and defines a standardized Java interface for word space algo-rithms. While other word space frameworks ex-ist, ... such as information retrieval, natu-ral language processing and cognitive psychology. For a recent survey of word space approaches andapplications, see (Turney and Pantel, 2010).The parallel...
- 6
- 410
- 0
Báo cáo khoa học: "A Multi-Document Summarization System for Scientific Article" docx
... , Giles C. L. and Kan M. 2008. ParsCit:An open- source CRF reference string parsing pack-age INTERNATIONAL LANGUAGE RESOURCESAND EVALUATION European Language ResourcesAssociationEdmundson, ... summary generated for a set of related scientific articles. This behaviour isdifferent from some other non-interactive summa-rization systems that might appear as a black boxand might not tailor ... WorkSurprisingly, not many approaches to the problem ofsummarization of scientific articles have been pro-posed in the past. Qazvinian et al. (2008) present a summarization approach that can be seen as theconverse...
- 6
- 343
- 0
Báo cáo khoa học: "Demonstration of Joshua: An Open Source Toolkit for Parsing-based Machine Translation" potx
... Jonathan Weese, and Omar Zaidan.200 9a. Joshua: An open source toolkit for parsing-based machine translation. In Proceedings of theFourth Workshop on Statistical Machine Transla-tion, pages ... modelling for statistical machine transla-tion. In Proceedings of ACL.Omar F. Zaidan. 2009. Z-MERT: A fully configurable open source tool for minimum error rate training ofmachine translation systems. ... method achieves a 90% reduction in training corpus size whilemaintaining state-of-the-art performance.• Suffix-array Grammar Extraction: Gram-mars extracted from large training corporaare often...
- 4
- 275
- 0
NiagaraCQ: A Scalable Continuous Query System for Internet Databases ppt
... initial writing of the paper. We are particularly grateful toAshraf Aboulnaga, Navin Kabra and David Maier for theircareful review and helpful comments on the paper. We alsothank the anonymous ... (1999).[MD89] D. McCarthy and U. Dayal. The architecture of anactive database management system. SIGMOD 1989: 215-224.[RC88] A. Rosenthal and U. S. Chakravarthy. Anatomy of a Modular Multiple Query ... NiagaraCQ can trigger continuousqueries. They are data -source change events and timer events.Data sources can be classified into push-based and pull-based.Push-based data sources will inform...
- 12
- 425
- 0
Tìm thêm: xác định các nguyên tắc biên soạn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25