9do ncrna transcripts play a role in v d j recombination
Báo cáo Y học: Does phosphorylation of the cap-binding protein eIF4E play a role in translation initiation? ppt
... and Trp102, the interaction being favoured by p-p stacking as indicated and the delocalized positive charge on the methylated guanine Several other interactions stabilize the biding of the cap-structure, ... translation across the board of mRNAs that are already actively being translated How could increased phosphorylation of eIF4E actually inhibit cap-dependent translation, as observed by Knauf et al ... untranslated under different conditions in a given cell type Microarray analyses have already been valuable in exploring translational control in several different systems [73,74] The availability...
- 10
- 504
- 0
báo cáo khoa học: " Do mitochondria play a role in remodelling lace plant leaves during programmed cell death?" pps
... 2C, denoted by asterisk) and showed absolutely no staining (Figure 3J and 3K) These mitochondria appeared to have dramatically degraded cristae and nearly indistinguishable membranes via TEM imaging ... NPCD, EPCD and LPCD stage cells illustrating variation in transvacuolar strand activity A) NPCD stage cells depicting several transvacuolar strands (black arrow), in which mitochondria and chloroplasts ... leaves was also indirectly examined via CsA pre-treatment Examination of CsA treated mitochondria revealed individual organelles, continued mitochondrial streaming and no loss in membrane potential...
- 18
- 219
- 0
báo cáo hóa học:" Spontaneous regression of curve in immature idiopathic scoliosis - does spinal column play a role to balance? An observation with literature review" pot
... final approval, JYH has contributed in acquisition of data and analysis and interpretation of data; and KPV and NM have contributed in revising the manuscript critically All authors read and approved ... contributed in conception and design of data, drafting the manuscript and given the final approval of manuscript, JHY has contributed in acquisition of data, revising the manuscript critically and given ... and lateral radiogram of whole spine including both hip joints and full length both lower limb radiograms by a single radiologist All radiograms were taken on a single X-ray machine to avoid any...
- 8
- 381
- 0
Báo cáo y học: "Migration events play significant role in genetic differentiation: A microsatellite-based study on Sikkim settlers" ppt
... populations of adjoining areas This substantiates that migratory events have played a significant role in the differentiation of mongoloids of India Background The origin, dispersal and antiquity ... Mukhopadhyay B, Bhattacharyya SK, Gupta R, Basu A: A genetic study among the Lepchas of the Darjeeling area of eastern India, Human Heredity 198 7a, 37: 113-121 Saha N, Mukhopadhyay B, Bhattacharyya ... 59) [40] and Karnataka (n = 65) [41] have been taken to be of the Indo-Caucasian origin Chinese and Caucasian data have been used for global population reference [42] Statistical Analysis: The...
- 27
- 625
- 0
Tài liệu Báo cáo khoa học: Golgi reassembly stacking protein 55 interacts with membrane-type (MT) 1-matrix metalloprotease (MMP) and furin and plays a role in the activation of the MT1-MMP zymogen pdf
... tag Full-length GRASP55, GRASP55 PDZ1 (amino acids 1–107), GRASP55 PDZ2 (amino acids 84–172) and GRASP55 region (amino acids 173–454) were fused to GAL4 DNA binding domain in the pBIND Checkmate ... (Clontech-Takara Bio Europe, Saint-Germain-en-Laye, France) DNA coding for MT1-MMP hinge, hemopexin, stalk, transmembrane and cytoplasmic domains (amino acids 283–582) was amplified by PCR and cloned downstream ... 9) had no effect on GRASP55 binding MT1-MMP ICD binds to PDZ2 domain and region of GRASP55 GRASP55 contains two non-overlapping and structurally independent PSD-95/SAP90 Drosophila septate junction...
- 18
- 603
- 0
Tài liệu Báo cáo khoa học: Differentiation stage-dependent preferred uptake of basolateral (systemic) glutamine into Caco-2 cells results in its accumulation in proteins with a role in cell–cell interaction pptx
... TVKPNANR IALDFQR GNDVAFHFNPRFNENNRR VIVCNTKLDNNW GREER QSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHR VK KLNEISKLGISGDIDLTSASYTMI Fig MALDI-TOF mass spectrum and coverage map of actin (A) and galectin-3 ... tricarboxylic acid cycle, succinate dehydrogenase flavoprotein subunit and fumarate hydratase, can play a role in the oxidative metabolism of glutamine via alpha-ketoglutarate to yield energy or to provide ... h, apical (AP) and basolateral (BL) Protein bands were made visible by Coomassie brilliant blue staining The 26 indicated protein bands were identified by MALDI-TOF MS and are depicted in Table...
- 15
- 506
- 0
Peptidylarginine deiminase (PAD) is a mouse cortical granule protein that plays a role in preimplantation embryonic development docx
... cortical granules contain PAD To ascertain if mouse cortical granules contain PAD, antibodies made against mouse ePAD and human recombinant PAD V (anti-PAD V (N)) were used to label in vivo matured ... used to determine that a putative signal peptide and a cleavage site exist in ePAD and AAH53724 (an egg and embryo abundant peptidylarginine deiminase), indicating they are likely secreted proteins ... orange nucleic acid stain and Alexa-488 conjugated to goat anti-rabbit IgG were obtained from Molecular Probes (Eugene, OR) PAD V (N) antibody was made against recombinant human PAD V and affinity...
- 22
- 519
- 0
Báo cáo khoa học: No evidence for a role in signal-transduction of Na+/K+-ATPase interaction with putative endogenous ouabain potx
... compound from human plasma Proc Natl Acad Sci USA 88, 6259–6263 Hansen, O (1989) Characterization of fatty acid interaction with ouabain and vanadate binding to (Na++K+) -activated ATPase Biochim ... rat by another group in collaboration with Hamlyn [21] by means of two independent assays, a radioimmunoassay using an anti-ouabain Ig and an enzymatic assay using ouabain-sensitive Na+/K+ATPase ... latter can be determined in [3H]ouabain binding studies In a membrane fraction from cardiac ventricles of adult rats, high-affinity Na+/K+ATPase containing a2 seemed to represent 26% of total activity...
- 4
- 423
- 0
Báo cáo hóa học: " Targeting the inflammation in HCV-associated hepatocellular carcinoma: a role in the prevention and treatment" pptx
... IKKe/TBK-1, via TRIF (TIRdomain-containing adapter-inducing interferon-b) joining the RIG-I/MDA5 pathway In the other pathway, TLR7 senses single-strand HCV RNA and via the MyD88 adaptor protein activates ... (DEN)inducedHCC) in rats Gallic acid treatment significantly attenuated some alterations (i.e increased levels of aspartate transaminase, alanine transaminase, alkaline phosphatase, acid phosphatase, lactate ... 124(11):2520-7 90 Jagan S, Ramakrishnan G, Anandakumar P, Kamaraj S, Devaki T: Antiproliferative potential of gallic acid against diethylnitrosamineinduced rat hepatocellular carcinoma Mol Cell Biochem...
- 11
- 649
- 0
báo cáo hóa học:" Triple-Nucleoside Analog Antiretroviral Therapy: Is There Still a Role in Clinical Practice? A Review" docx
... California Abstract 51 Staszewski S, Keiser P, Montaner J, et al.: Abacavir-lamivudinezidovudine vs indinavir-lamivudine-zidovudine in antiretroviral-naive HIV-infected adults: A randomized equivalence ... associated with high rates of early failure have included ABC + 3TC + TDF, ddI + 3TC + TDF, and ABC + ddI + TDF All of these agents appear to have decreased activity against HIV with K65R in vitro ... Abstract Farthing C, Khanlou H, Yeh V: Early virologic failure in a pilot study evaluating the efficacy of once daily abacavir (ABC), lamivudine (3TC) and tenofovir DF (TDF) in treatment naive...
- 8
- 342
- 0
Báo cáo y học: "Do the pleiotropic effects of statins in the vasculature predict a role in inflammatory diseases" pdf
... have utility in disease states beyond atherogenesis Sparrow and colleagues demonstrated that simvastatin had a comparable antiinflammatory effect to that of indomethacin in the carrageenan-induced ... statin therapy on inflammatory airway disease After priming and intra-nasal ovalbumin challenge, reductions in inflammatory cell infiltrate and eosinophilia in bronchoalveolar lavage fluid were ... statins in the primary prevention of cardiovascular events was observed in the WOSCOPS trial [9] Pravastatin was shown to decrease cardiovascular events and mortality by about 30% in middle-aged...
- 7
- 334
- 0
Báo cáo y học: "Endogenous and exogenous stem cells: a role in lung repair and use in airway tissue engineering and transplantation" pdf
... Y, Tada Y, Miyake M, Hazama A, Wada I, Nakamura T, Omori K: A tissue-engineered trachea derived from a framed collagen scaffold, gingival fibroblasts and adipose-derived stem cells Biomaterials ... Komura M, Komura H, Kanamori Y, Tanaka Y, Suzuki K, Sugiyama M, Nakahara S, Kawashima H, Hatanaka A, Hoshi K, Ikada Y, Tabata Y, Iwanaka T: An animal model study for tissue-engineered trachea fabricated ... 88 Bader A, Machens HG: Recombinant human erythropoietin plays a pivotal role as a topical stem cell activator to reverse effects of damage to the skin in aging and trauma Rejuvenation Res doi:10.1186/1423-0127-17-92...
- 9
- 487
- 0
Báo cáo khoa học: "Herpes simplex virus type 2 tegument protein UL56 relocalizes ubiquitin ligase Nedd4 and has a role in transport and/or release of virions" ppt
... proteinprotein interacting WW domains and a carboxyl terminal catalytic HECT domain [4] Viruses depend heavily on functions provided by their host cells as intracellular parasites, and as such, have evolved ... analysis and review of the manuscript YN performed project planning, participated in the data analysis and helped to draft the manuscript All authors read and approved the final manuscript Weissman AM: ... mRFP-UL56 was detected in a vesicular pattern and the puncta moved around the cytoplasm (Fig 1B; additional file [movie 2]) mRFP-UL56 puncta varied in size and moved in the different directions and at...
- 13
- 290
- 0
báo cáo khoa học: " Co-expression and promoter content analyses assign a role in biotic and abiotic stress responses to plant natriuretic peptides" pptx
... Ishida J, Narusaka M, Fujita M, Nanjo T, Umezawa T, Kamiya A, Nakajima M, Enju A, Sakurai T, Satou M, Akiyama K, YamaguchiShinozaki K, Carninci P, Kawai J, Hayashizaki Y, Shinozaki K: Monitoring the ... 48:180-188 Verslues PE, Bray EA: Role of abscisic acid (ABA) and Arabidopsis thaliana ABA-insensitive loci in low water potentialinduced ABA and proline accumulation J Exp Bot 2006, 57:201-212 Denby ... processes in which AtPNP -A is involved If such a mutant demonstrated a compromised SAR response, it would greatly strengthen the claim that AtPNP -A is indeed involved in the SAR response pathway Additionally,...
- 12
- 396
- 0
Báo cáo y học: "bench-to-bedside review: Endothelial cell dysfunction in severe sepsis: a role in organ dysfunction" pdf
... oxygen demand and supply within an individual organ in an in vivo model of endothelial stripping in the dog hind limb [66] The hind limb vascular endothelium was removed by injecting deoxycholate into ... 1-deamino-8 -D- arginine vasopressin in humans Blood 1996, 88:2951-2958 Van Mourik JA, Boertjes R, Huisveld IA, Fijnvandraat K, Pajkrt D, van Genderen PJ, Fijnheer R: von Willebrand factor propeptide in vascular ... TM and associated protein C activation represents the key event of decreased endothelial coagulation modulation ability and increased inflammation pathways Adapted from Iba and coworkers [88] ATIII,...
- 9
- 407
- 0
Báo cáo khoa học: "Do statins have a role in preventing or treating sepsis" pptx
... oxygenase (HO)-1 is an inducible, heat shock cytoprotective protein Simvastatin activates and increases HO-1 in a concentration-dependent and time-dependent manner This induction was observed in vascular ... using various models indicate that statins profoundly affect NO availability [5,12-14] Specifically, in a rat pretreatment model simvastatin decreased NO overproduction and reverted the impaired ... protective effect was independent of comorbidities and dissipated when the medication was discontinued There is growing interest among clinicians in the role that statins may play in preventing and...
- 3
- 260
- 0
Báo cáo y học: "RNA interference has a role in regulating Drosophila telomeres" potx
... Theurkauf WE, Zamore PD: RISC assembly defects in the Drosophila RNAi mutant armitage Cell 2004, 116:831-841 Abad JP, De Pablos B, Osoegawa K, De Jong PJ, Martin-Gallardo A, Villasante A: TAHRE, a ... is under the control of the RNAi-based mechanism in the Drosophila germline Genes Dev 2006, 20:345-354 Vagin VV, Klenov MS, Kalmykova AI, Stolyarenko AD, Kotelnikov RN, Gvozdev VA: The RNA interference ... have been shown to be involved in transcriptional silencing in plants [12], Caenorhabditis elegans [13] and mammals [14], and in genome rearrangements in Tetrahymena [15], suggesting that RNAi...
- 5
- 223
- 0
Running and adult neurogenesis does septohippocampal sonic hedgehog play a role
... (Vaynman et al., 2003)and (iii) a rise in vesicular budding protein synapsin I expression(Adlard et al., 200 5a; Vaynman et al., 200 4a; Vaynman et al., 2006) Another study suggested that running ... pathway and contralateral CA3 and CA1 pyramidal cells via the Associational/Commissural fibres Another extrahippocampal source of input to the DG and CA3 comes from the medial septum and diagonal ... increase vascularisation to the DG (van Praag et al., 2007) Running did not bring about a change in vascular permeability in the brain as well, even with the addition of the permeability-enhancing...
- 212
- 367
- 0
báo cáo hóa học:" Immunological response to highly active antiretroviral therapy following treatment for prevention of mother to child transmission of HIV-1: a study in Côte d’Ivoire" pdf
... collected immunological and clinical data Other study variables measured at time of HAART initiation were included in the analysis: age, WHO clinical stage, body mass index, hemoglobinemia at HAART initiation, ... USA Authors’ contributions DKE, PAC and FD designed the study PAC and CAB collected the data DKE and PC analyzed the data DKE and PAC interpreted the data All authors contributed to the writing ... our study area Such data is important to fully understand the dynamics and rate of treatment failure in our population Switching treatments without using viral load data for making these decisions...
- 5
- 407
- 0
Tìm thêm: khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến tốc độ rôto n fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose