4—requirements for anchor identification p 355 2 5

Oxford collocations dictionary for students of english chương 2 4

Ngày tải lên : 19/08/2013, 09:53

... life's great pleasures • PREP on Wedined onfresh localfish • ADV • PREP below The sun dipped below the horizon prices/support, etc • ADV slightly I sharplySupportdippedsharplyt 051 % diphtheria • ... sth up for, come up for, open sth up for The issue should come up for discussion at the climate change conference The topic must be opened up for general discussion I open up We need to open up ... fast/rapidly disappearing disappearance noun • ADJ abrupt, sudden How could he explain his abrupt disappearance from the party? I rapid the rapid disappearance of our countryside I gradual I complete,...

58
726
1

Tài liệu Oxford Collocations Dictionary for students of English_ Chương 2.4 pdf

Ngày tải lên : 10/12/2013, 13:15

... life's great pleasures • PREP on Wedined onfresh localfish • ADV • PREP below The sun dipped below the horizon prices/support, etc • ADV slightly I sharplySupportdippedsharplyt 051 % diphtheria • ... sth up for, come up for, open sth up for The issue should come up for discussion at the climate change conference The topic must be opened up for general discussion I open up We need to open up ... fast/rapidly disappearing disappearance noun • ADJ abrupt, sudden How could he explain his abrupt disappearance from the party? I rapid the rapid disappearance of our countryside I gradual I complete,...

58
631
0

iec 60269-2-1 low-voltage fuses - supplemetary requirements for fuses for use by authorized perso

Ngày tải lên : 25/12/2013, 10:47

... TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT ,F, ,

264
753
4

iec 60269-2 low-voltage fuses - supplementary requirements for fuses for use by authorized person

Ngày tải lên : 25/12/2013, 10:53

... A 10 12 16 20 25 32 40 50 63 80 1O0 1 25 160 20 0 25 0 3 15 400 50 0 630 800 O00 1 25 0 Cross-sởctionai area rnmZ 1 ,5 1 ,5 23 2. 5 2. 5 10 16 25 25 35 50 70 95 120 1 85 24 0 x 150 or x (30 x ) x 1 85 or x ... pour les essais des ộlộments de remplacement aM Courant assignộ A Section 10 12 16 20 25 32 40 50 63 80 1O0 1 25 160 20 0 25 0 31 400 50 0 630 800 O00 1 25 0 1 .5 1,s 13 2, s 2, s 2. 5 10 16 25 25 35 50 ... the prokction o semiconductordevices f 28 2- High-voltagefuses P r 1: Current-limiting fuses at 28 2-1 (1994) 28 2 -2 (19 95) Partie Coupe-circuit expulsion 28 2 -2 (19 95) P r 2: Expulsion fuses at 28 2-3...

30
315
3

iec 60269-4-1 low-voltage fuses - supplementary requirements for fuse-links for the protection of

Ngày tải lên : 25/12/2013, 10:54

... 31,8 5 ,2 25, 8 9,1 12, 3 22 5 – 800 99 ,2 70,6 79 55 ,5 42, 1 51 ,2 6,8 38 ,5 12, 3 20 ,2 35 – 60 82, 6 62, 7 67 ,5 54 42, 9 21 3,6 19 ,5 9,1 13,6 65 – 100 93 ,5 73,0 79 66 ,5 55, 6 25 ,8 3,7 19 ,5 9,3 17,9 110 – 20 0 ... 76 ,5 66 ,5 55, 7 31,4 5 ,2 25, 8 9,1 15, 5 22 5 – 400 111,9 83,3 89 68 54 ,8 38 ,5 6,8 25 ,8 11,4 19,9 450 – 600 1 15, 6 86 ,5 91 ,5 69 58 51 ,2 6,8 38 ,5 12, 3 20 ,2 700 – 800 166 110,0 128 85, 5 58 63,9 10,1 51 ,2 ... 5 ,2 25, 8 9,1 12, 3 22 5 – 800 99 ,2 70,6 79 55 ,5 42, 1 51 ,2 6,8 38 ,5 12, 3 20 ,2 35 – 60 82, 6 62, 7 67 ,5 54 42, 9 21 3,6 19 ,5 9,1 13,6 65 – 100 93 ,5 73,0 79 66 ,5 55, 6 25 ,8 3,7 19 ,5 9,3 17,9 110 – 20 0...

42
420
2

iec 60269-4 low-voltage fuses - supplementary requirements for fuse-links for the protection of s

Ngày tải lên : 25/12/2013, 10:55

... about this message: please call the Document Policy Group at 303-397 -22 95 8 10 10 10 10 12 12 12 12 12 14 14 14 14 18 18 20 20 20 20 20 20 20 20 20 22 22 24 26 28 32 36 39 42 54 `,,`,`,``,````,,,,,`,````,```-`-`,,`,,`,`,,` ... the 12tcharacteristicsand overcurrent discrimination 9 11 11 11 11 13 13 13 13 13 15 15 15 15 19 19 21 21 21 21 21 21 21 21 21 23 23 25 27 29 33 37 FIGURES 39 APPENDIX- ... Page 10 2. 2.1O Catộgorie demploi (dun ộlộment de remplacement) Supprimer ce paragraphe Page 16 Ajouter, aprốs le paragrap e 5. 6.4 2, le nouveau paragraphe 5. 7.1 su .ant: 5. 7.1 Pouvoir de coupure...

87
404
1

iec 60439-2 low-voltage switchgear and controlgear assemblies - particular requirements for busba

Ngày tải lên : 25/12/2013, 11:05

... température de +20 OC,par mètre de longueur: - phase phase - ßbO phN phase neutre - ßbO phPEN phase PEN - - ßbO phph ßbO phPE phase PE la résistance ohmique moyenne des conducteurs considérés, pour ... considérés, pour le courant assigné INc, la fréquence assignée f , par mètre de longueur: - xb phph phase phase - xb phN phase neutre - Xb phPEN phase PEN - Xb phPE phase PE NOTE Ces valeurs peuvent ... assigné INC, la température de stabilisation thermique 8, du système, par mètre de longueur: - ßbl phph phase phase - ßbl phN phase neutre - ßbl phPEN phase PEN - ßbl phPE phase PE - la réactance...

74
820
14

iec 60439-4 low-voltage switchgear and controlgear assemblies - particular requirements for assem

Ngày tải lên : 25/12/2013, 11:07

... applicable (see 2. 1.1.3) 2. 5 .2 ASSEMBLY outdoor installation for Not applicable (see 2. 1.1.3) 2. 5. 3 Stationary ASSEMBLY Not applicable 2. 5. 4 Movable ASSEMBLY Not applicable 2. 5. 5 Transportable (or ... s'applique pas (voir 2. 1.1.3) 2. 5. 3 ENSEMBLE fixe Ne s'applique pas 2. 5. 4 ENSEMBLE dộplaỗable Ne s'applique pas 2. 5. 5 EC transportable (ou semi-fixe) EC prộvu pour ờtre utilisộ un emplacement donnộ ... 2. 4 .2) 2. 3.4 Canalisation prộfabriquộe Ne s'applique pas 2. 5. 1 ENSEMBLE pour installation l'intộrieur Ne s'applique pas (voir 2. 1.1.3) 2. 5 .2 ENSEMBLE pour installation l'extộrieur Ne s'applique pas...

56
514
5

Báo cáo khoa học: Structural requirements for the apical sorting of human multidrug resistance protein 2 (ABCC2) potx

Ngày tải lên : 31/03/2014, 09:20

... ( 151 0– 154 5) GFP–MRP2 GFP–MRP2D7 GFP–MRP2D11 GFP–MRP2D 15 GFP–MRP2D20 GFP–MRP2D 25 GFP–MRP2D 25 MAKE GFP–MRP2D50 GFP–MRP2D100 73 69 65 16 15 1 18 18 20 17 64 59 59 64 35 13 15 67 20 33 32 35 65 GKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF ... Construct % Apical % Vesicles % ER C-Terminal sequence ( 151 6– 154 5) GFP–MRP2 GFP–MRP2D3 GFP–MRP2-T 154 3A GFP–MRP2D 15 GFP–MRP2D15TKF 73 64 67 16 21 18 13 16 17 21 23 17 67 58 GSPEELLQIPGPFYFMAKEAGIENVNSTKF ... A.F & Keppler, D (20 00) MRP2, a human conjugate export pump, is present and transports Fluo-3 into apical vacuoles of HepG2 cells Am J Physiol 27 8, G 52 2 –G531 Keppler, D & Konig, J (1997) Expression...

11
523
0

Converging Technologies for Improving Human Performance Episode 2 Part 4 pdf

Ngày tải lên : 05/08/2014, 21:20

... Technologies for Improving Human Performance (pre-publication on-line version) 25 5 Productivity is a function of knowledge and skill, i.e., technology Growth in productivity depends on improved technology ... Technologies for Improving Human Performance (pre-publication on-line version) 25 3 Implications for the Future Clearly, the ability to build highly intelligent machine systems will have profound implications ... COGNITION TO ENHANCE HUMAN PERFORMANCE William A Wallace, Rensselaer Polytechnic Institute The purpose of this paper is to provide a rationale for a new program whose purpose would be the integration...

20
413
0

Advanced Mathematical Methods for Scientists and Engineers Episode 2 Part 4 ppsx

Ngày tải lên : 06/08/2014, 01:21

... , C2 and C2 C z dz = z3 − C1 z− + √ C2 z− C3 z− + = 2 + 2 + 2 z− √ √ √ z− z− z √ dz e 2 /3 z − e− 2 /3 z √ √ dz 2 /3 z − 9e z − e− 2 /3 z √ √ dz z − e 2 /3 z − e− 2 /3 z− 9 √ z e 2 /3 ... a lower and 53 0 upper bound for the series ∞ 1 dx ≤ x2 ∞ n=1 ≤1+ n2 ∞ 1≤ n=1 ∞ 1 dx x2 2 n2 1 Figure 12. 1: Upper and Lower bounds to In general, we have ∞ ∞ a(x) dx ≤ m ∞ n=1 1/n2 ∞ an ≤ am ... = and z = −1 Let C1 and C2 be contours around z = and z = −1 See Figure 11.6 We deform C onto C1 and C2 = C + C1 52 0 C2 -4 C1 C2 -2 C -2 -4 Figure 11 .5: The contours for (z +z+ı) sin z z +ız...

40
337
0

Specifications, Tolerances, and Other Technical Requirements for Weighing and Measuring Devices Episode 4 pptx

Ngày tải lên : 12/08/2014, 07:22

... 19 26 32 65 97 110 130 130 190 23 0 23 0 26 0 26 0 320 mg 10 15 20 25 30 40 5. 0 7.0 9.0 11.0 15 17 19 21 23 25 28 30 35 40 45 320 450 58 0 710 970 1190 120 0 1400 150 0 1600 1800 1900 23 00 26 00 29 00 50 ... 2. 5 2. 9 3.7 5. 4 mg 1 15. 0 1 25 .0 130.0 1 35. 0 1 45. 0 mg 155 .0 160.0 190.0 24 0.0 350 .0 oz 100 20 0 300 50 0 1000 grains 7.7 12. 3 15. 4 23 .1 38.6 mg 50 0.0 800.0 1000.0 150 0.0 25 00.0 2- 66 Handbook 44 - 20 07 ... 0 .20 0.30 0.40 0 .50 0.60 grains 0.06 0.10 0. 15 0 .20 0.30 0.40 mg 4 .5 6 .5 13.0 20 .0 25 .0 30.0 40.0 mg 4.0 6 .5 10.0 13.0 20 .0 25 .0 oz 10 oz 11 12 20 30 50 grains 1.8 1.9 2. 0 2. 1 2. 2 grains 2. 4 2. 5...

29
351
0

Longman-Grammar and Vocabulary for Cambridge Advanced and Proficiency (2)

Ngày tải lên : 05/10/2012, 09:51

... reporting and interpreting Communicating Exam practice 13 21 8 22 0 22 2 25 2 • Syllabus map Unit one page 16 Grarnrnar Probiem tmses Present Perfect Present Perfect with other tenses; idiomatic phrases ... Exam practice 15 24 6 24 8 25 0 Reported speech Entry test 21 2 Progress test OVERVIEW 21 3 (testing contents of Units - 15) SECTION I SECTION Tenses in reported speech Report structures 21 4 21 6 Vocabulary ... Ernp hasis SECTION Dependent prepositions and prepositional phrases Expressing knowledge and belief 23 0 23 8 Verb cornplernentation Entry test SECTION I SECTION SECTION 20 6 20 8 Exam practice 12 210...

288
1.8K
23

Báo cáo y học: "Efficiency of vibration exercise for glycemic control in type 2 diabetes patients."

Ngày tải lên : 26/10/2012, 10:04

... ml) 120 ± 25 126 ± 23 133 ± 57 Plasma [glucose] posttraining (mg / 100 ml) 1 15 ± 22 120 ± 22 122 ± 35 Significance n.s n.s n.s HbA1C At baseline the HbA1c amounted to 6,7 % ± 0 ,26 (FT), 6,8 % ... loads of 89 w ± 8 ,2 (pre) and 86 w ± 9,7 (post), 99 w ± 14,8 (pre) and 95 w ± 13,3 (post), 89 w ± 6 ,2 (pre) and 92 w ± 5, 9 (post) for FT, ST, and VT, respectively In contrast, at these loads heart ... group (number of subjects) Age (years) Weight (kp) Height (cm) Stretching (13) Strength (13) 63,3 ± 5, 9 62, 9 ± 7,3 62, 2 ± 4,0 88,6 ± 24 ,1 86 ,5 ± 14,7 83,3 ± 13,4 173 ± 14 ,2 1 72 ± 6,7 177 ± 7,2...

5
544
0

A research proposal submitted in partial fulfillment of the requirements for the degree of Master of Business Administration

Ngày tải lên : 13/04/2013, 10:30

... Heavy-users (nhu = 50 ) Differences Age % less 20 years 21 - 25 26 -30 31- 35 36-40 41- 45 more 45 years 4 .5 20 .5 15. 9 15. 9 20 .5 18 .2 4 .5 20 .0 20 .0 More people in 32. 0 age of 25 - 35 18.0 4.0 lower ratio ... % 42. 6 45 40 35 30 25 .6 25 17.6 20 15 9.1 10 1.7 2. 3 1.1 person Figure 3 .2: Family size 60 % 52 . 8 50 40 28 .4 30 20 10 6.8 5. 7 5. 7 0.6 23 more million 4 -5 million 3-4 million 2- 3 million 1 -2 million ... salespersons shopping atmosphere 3 .55 11.4 2. 3 4.34 52 . 0 4.0 product display 3.80 18 .2 0.0 4. 52 66.0 0.0 10 air conditioning 3.66 20 .5 4 .5 4. 12 30.0 2. 0 11 check out 3.61 20 .5 6.8 4.30 40.0 2. 0 12...

51
1K
3

Unit 4: Lesson 3: B1-5/ p. 47-48

Ngày tải lên : 23/06/2013, 01:26

... 10th Unit 4: Lesson 3: B1 -5/ p 47-48 III Dialogue: Vocabulary: - grade: l p - floor : tÇng ( lÇu ) Listen to the tape: Complete this table: Grade Thu Phong Class 7c 6A Thu Phong Classroom’s floor ... Unit 4: Lesson 3: B1 -5/ p 47-48 I Ordinal numbers: the first = 1st the second = 2nd the third = 3rd the fourth = 4th the fifth = 5th II Listen and repeat: the sixth = 6th the seventh ... … am P: I … in class 6A is T Where … your classroom ? P: It’ s on the first floor … Unit 4: Lesson 3: B1 -5/ p 47-48 V Practice with a partner: Which grade are you in ? How many floors does your...

9
677
1

Unit 4: Lesson 5: C1-3/ p.49

Ngày tải lên : 23/06/2013, 01:26

... morning? - S2: I get up Then I - S3: Every morning, he/she gets up Then he/she gets dressed Unit 4: Lesson 5: C1-3/ p. 49 III Practice: Picture drill Unit 4: Lesson 5: C1-3/ p. 49 III Practice: ... Lesson 5: C1-3/ p. 49 II Model sentences: The present simple - What does Ba every morning? he she - Ba brushes his / her teeth He gets up She has breakfast goes to school Unit 4: Lesson 5: C1-3/ p. 49 ... singular posernal pronouns: (he, she, it) need to add: “-s” or “-es” -Adding “-es” with the verbs have the end: “ o, s, x, ch, sh” Unit 4: Lesson 5: C1-3/ p. 49 III Practice: have breakfast get up brush...

21
463
0

Unit 4: Lesson 6: C4-7/ p.50-51

Ngày tải lên : 23/06/2013, 01:26

... 6: C4-7/ p. 50 -51 IV Practice: Eg: * PICTURE DRILL: C.7 P. 51 S1: What time you get up? S2: At six o’clock 6. 15 6.30 6 .20 7.00 6 .50 Unit 4: Lesson 6: C4-7/ p. 50 -51 IV Practice: C6 /p. 51 Read the ... C4-7/ p. 50 -51 I Number dictation: 1.10 4.30 5 .20 3. 15 6.40 7.40 2. 55 11 .50 10.30 12. 25 II Vocabulary: - the time: thêi gian Eg: ten o’clock, half past ten - late (adj): trÔ, muén to be late for ... and crosses O1 O2 O3 O4 O5 O6 O7 O8 O9 X X X o o o 6.10 O X 7.00 6.30 O X 12. 0 7 .50 5. 45 O X O X O O X X 3. 15 9.10 4 .20 X1 X2 X3 X4 X5 X6 X7 X8 X9 Unit 4: Lesson 6: C4-7/ p. 50 -51 Remember - What...

14
426
1

kiem tra 45 p chuong 2

Ngày tải lên : 25/06/2013, 01:26

... Câu 26 : Trên mặt thoáng chất lỏng có hai nguồn kết h p A B cách 5cm, phương trình dđ A B có dạng: u = a cos 60πt (cm) Vận tốc truyền sóng mặt thoáng v = 60cm/s Pha ban đầu sóng tổng h p 5 5 ... ) Li độ vận tốc vật thời điểm t= 0 , 25 s : A 2cm 4π cm/sB - 2cm 8π cm/sC - 2cm - 8π cm/sD 4cm 16π cm/s Câu 29 : Một lắc đơn dao động điều hòa nơi có g = 10m/s 2, chiều dài dây treo l = 1,6m với ... có li độ : A 8cm B -8cm C 9cm D 6cm Câu 22 : Một dây đàn có chiều dài L, hai đầu cố định Sóng dừng dây có bước sóng dài A L/4 B L /2 C L D 2L Câu 23 : Chọn phát biểu Vận tốc truyền âm:A Có giá trị...

3
317
0