2 a plates — less than 3 4 in 19 mm thickness performance qualification
Tài liệu 2004 ASME BOILER & PRESSURE VESSEL CODE docx
... UNC 147 (20 0.0) 1 32 (180.0) ⁄8 (22 .2) ⁄8 (22 .2) 14 UNF UNC 23 4 ( 32 0 .0) 21 2 (28 5.0) (25 .4) (25 .4) 12 UNF UNC 34 8 (47 0.0) 31 8 ( 43 0 .0) 5 7 9 3 7 QW-1 92. 4 Acceptance Criteria — Macro-Examination In ... QW -20 2 .4( b)(1) Revised 20 QW -25 2 QW -40 4. 12 revised 21 QW -25 2.1 QW -40 4. 12 and QW -40 8. 14 revised 22 QW -25 3 QW -40 4. 12 and QW -40 4 .33 revised 23 QW -25 3. 1 (1) QW -40 4. 12 and QW -40 7.6 revised (2) QW -40 7.9 ... Resale Page Location Change 39 QW -25 9 (1) Title corrected by errata (2) QW -40 4. 12 and QW -40 4 .33 revised 40 QW -26 0 QW -40 4 .33 revised 44 QW -26 4 QW -40 4 .33 revised 45 QW -26 4. 1 (1) QW -40 4 and QW -40 7.6...
- 309
- 1,961
- 9
Báo cáo khoa học: MR solution structure of the precursor for carnobacteriocin B2, an antimicrobial peptide fromCarnobacterium piscicola Implications of the a-helical leader section for export and inhibition of type IIa bacteriocin activity pdf
... VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGS IGRRP [19] Sakacin G Plantaricin 4 23 Piscicolin 126 CbnBM1 Leucocin A Pediocin Mesentericin Y105 Sakacin A Divercin V41 Sakacin P MKNAKSLTIQEMKSITGG MMKKIEKLTEKEMANIIGG ... Isolation, purification and partial characterization of plantaricin 4 23 , a bacteriocin produced by Lactobacillus plantarum J Appl Microbiol 84, 1 131 –1 137 22 Jack, R.W., Wan, J., Gordon, J., Harmark, ... organization Microbiology 144 , 28 37 28 44 28 Tichaczek, P.S., Vogel, R.F & Hammes, W.P (19 94) Cloning and sequencing of sakP encoding sakacin P, the bacteriocin produced by Lactobacillus sake LTH 673...
- 9
- 519
- 0
Báo cáo y học: "Proton-pump inhibitors are associated with a reduced risk for bleeding and perforated gastroduodenal ulcers attributable to non-steroidal anti-inflammatory drugs: a nested case-control study" pptx
... 57 (20 .1) 1. 93 1.17 3 .20 0.009 ACE inhibitors 24 ( 23 .1) 32 (11 .3) 2. 36 1. 32 4 .25 0.0 03 Digoxin (7.8) 11 (3. 9) 2. 09 0. 82 5 .35 0. 12 Beta-blockers 22 (21 .2) 64 (22 .5) 0. 92 0. 53 1.59 0.77 Nitrates ... 0 .31 0.15–0.66 0.0 02 Melaena 65 ( 62. 5) Coumarin 2. 38 1. 03 5 .48 0. 04 Haematemesis 28 (26 .9) Heart failure 2. 10 1. 04 4 .21 0. 04 Perforation 12 (11.5) Acetaminophen 2. 47 1 .39 4 .39 0.0 02 Stomach pain ... gastrointestinal ulcers 16 (15 .4) 33 (11.7) 1 .37 0. 72 2. 60 0 . 34 Malignancy 15 ( 14. 4) 26 (9 .2) 1.67 0.85 3. 30 0. 14 Rheumatoid disease, including OA 42 (40 .4) 97 ( 34 .2) 1 .31 0. 82 2. 07 0 .26 Scores are means...
- 8
- 459
- 0
Báo cáo y học: "κ The roles of the classical and alternative nuclear factor-κB pathways: potential implications for autoimmunity and rheumatoid arthritis" ppsx
... HE, Zhang Y, Paige CJ: Mechanisms of 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 selection mediated by interleukin-7, the preBCR, and hemokinin-1 during B-cell development Immunol ... 20 05, 20 8 :19 -29 119 Nakajima H, Takatsu K: Role of cytokines in allergic airway inflammation Int Arch Allergy Immunol 20 07, 1 42 : 265 -27 3 120 Linden A: A role for the cytoplasmic adaptor protein ... 20 07 :28 5 -29 6 Available online http://arthritis-research.com/content/10 /4 /21 2 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 Hayden MS, Ghosh S: Signaling to NF-kappaB Genes Dev 20 04, 18 :21 95 -22 24...
- 14
- 317
- 0
Guide to Design Criteria for Bolted and Riveted Joints
... A5 88- 84 A5 37 - 84 A5 14- 8 4a 36 42 - 5 0a 40 -50 a 42 - 65 a 42 - 50 a 45 -60 a 90-100 a 58-80 63- 70 a 60-70 a 60-80 a 63- 70 a 70-100 a 100- 130 a 20 18 18 15 -20 a 18 18 -22 a 17-18 a a Fig 2. 3 Minimum specified ... 197 12. 2 Effect of Type of Coating on Short-Duration Slip Resistance, 198 12. 2.1 Hot-Dip Galvanizing, 198 12. 2 .2 Metallizing, 20 2 12. 2 .3 Zinc-Rich Paints, 20 2 12. 2 .4 Vinyl-Treated Surfaces, 20 6 ... 13. 4 Comparison of Analytical and Experimental Results, 22 5 13. 5 Design Recommendations, 22 7 13. 5.1 Connected Material, 22 7 13. 5 .2 Fasteners, 22 7 14 Combination Joints 23 2 14. 1 Introduction, 23 2...
- 352
- 561
- 1
aisc design criteria for bolted and riveted joints
... A5 88- 84 A5 37 - 84 A5 14- 8 4a 36 42 - 5 0a 40 -50 a 42 - 65 a 42 - 50 a 45 -60 a 90-100 a 58-80 63- 70 a 60-70 a 60-80 a 63- 70 a 70-100 a 100- 130 a 20 18 18 15 -20 a 18 18 -22 a 17-18 a a Fig 2. 3 Minimum specified ... 197 12. 2 Effect of Type of Coating on Short-Duration Slip Resistance, 198 12. 2.1 Hot-Dip Galvanizing, 198 12. 2 .2 Metallizing, 20 2 12. 2 .3 Zinc-Rich Paints, 20 2 12. 2 .4 Vinyl-Treated Surfaces, 20 6 ... 13. 4 Comparison of Analytical and Experimental Results, 22 5 13. 5 Design Recommendations, 22 7 13. 5.1 Connected Material, 22 7 13. 5 .2 Fasteners, 22 7 14 Combination Joints 23 2 14. 1 Introduction, 23 2...
- 352
- 511
- 0
Báo cáo khoa học: Functional analysis of cell-free-produced human endothelin B receptor reveals transmembrane segment 1 as an essential area for ET-1 binding and homodimer formation pptx
... T3 C2 T4 E2 T5 C3 T6 E3 T7 CTD C-terminal tag ETBDT7 ETBcHx ETBStrep ETB 131 ETB168 ETB2 03 ETB306 ETB1 32 ETB2 04 ETB307 ETB 93 M1–S4 43 Q2–S4 43 E27–S4 43 E27–C 131 E27–P168 E27–V2 03 E27–G306 M1 32 S4 43 ... Biochem 24 8, 139 – 148 FEBS Journal 27 4 (20 07) 32 5 7– 32 6 9 ª 20 07 The Authors Journal compilation ª 20 07 FEBS C Klammt et al 28 Ozawa K, Headlam MJ, Schaeffer PM, Henderson BR, Dixon NE & Otting G (20 04) ... ligands BQ- 1 23 and [Ala1 ,3, 11,15]ET-1 Biochem Biophys Res Commun 1 82, 144 –150 40 Saeki T, Ihara M, Fukuroda T, Yamagiwa M & Yano M (199 1) [Ala1 ,3, 11,15]Endothelin-1 analogs with ETB agonistic activity...
- 13
- 433
- 0
English for Tourism and Hospitality 1
... Certainly Certainly Just a minute please Answers: 1) Good morning, Plaza Hotel Leo speaking 2) Good morning, Plaza Hotel Leo speaking How can I help you? 1) Just a minute please 2) Would you mind ... Key vocabulary Look up the meaning and pronunciation of these words in your dictionary reservation book cost single certainly per night arrive just leave available require sure Language Point Complete ... the words in the correct order After you have checked your answers, read each sentence out loud please a just minute _ mind you would please holding? I while...
- 2
- 2,880
- 63
English for Tourism and Hospitality 1
... single rooms? Mona: Thank you Leo: Can I have your name please? Mona: My name is Mona White Leo: And your father's name please, Ms White Mona: Jack Webber Leo: Could you spell the surname please? ... speaking" - theo thông lệ, giao tiếp qua điện thoại, để người biết bạn ai, bạn nên dùng từ 'speaking' sau xưng tên Nào mời bạn nghe lập lại câu sau Leo: Leo speaking Mona: Mona speaking Jack: Jack ... Mona: Yes, thank you Leo: Can I have your name please? Mona: My name is Mona White Leo: And your father' name, Ms White? Mona: Jack Webber Leo: Could you spell the surname, please? Mona: Sure,...
- 7
- 1,039
- 5
Tài liệu SECTION TWO: Structure and Written Expression (1) ppt
... B 12 B 13 B 14 C 15 B 16 A 17 D 18 A 19 D 20 A 21 A 22 A 23 D 24 A 25 B 26 B 27 D 28 B 29 B 30 C 31 A 32 B 33 D 34 C 35 A 36 A 37 B 38 C 39 B 40 D ... a various of skin cancers and destroy (A) (B) tiny plants at the beginning of the food chain (C) (D) 36 The reason automobiles travel on left side in Japan has little to with Britain and a (A) ... commercial uses (A) shaped like a flint (B) flint-shapes (C) shape of a flint (D) flint-shaped “Letters from the Earth” is actually of essays, written from 191 0 until his death in 1 937 (A) a...
- 6
- 1,755
- 42
Tài liệu A resource for reading and words part 1 ppt
... defined above After breakfast I take a around the base checking that all the daily tasks have been completed for signs of damage and only store those in perfect condition in paper sacks in a ... office works alone in the office enjoys walking in the park We can infer from the passage that - A) it was a fine autumn day B) the weather was very cold C) it was a beautiful summer day D) Doole ... to find a way to our fifty thousand members as an educational and propaganda machine Music, obviously, can make a mood, build familiarity and memory, and for an happy event He has always been...
- 15
- 706
- 3
Tài liệu Báo cáo khoa học: A facile method for expression and purification of the Alzheimer’s disease-associated amyloid b-peptide pdf
... following primers: Aba, 5¢-ATGGACGCTGAAT TCCGTCACGACTCTGGTTACGAAGTTCACCACCAG AAGCTGGTG -3 ; Abb, 5¢-GTTCACCACCAGAAGCT GGTGTTCTTCGCTGAAGACGTGGGTTCTAACAAG GGTGCT -3 ; Abc, 5¢-CACAACGCCACCAACCATCAGA CCGATGATAGCACCCTTGTTAGAACCCAC -3 ; ... SECisolated Ab(1 40 ) and Ab(M1 40 ) are at least 97% pure In the lanes containing Ab(1– 42 ) and Ab(M1– 42 ) , there were prominent bands at approximately kDa and faint bands at approximately 14 kDa The band ... 5¢-CACAACGCCACCAACCATCAGA CCGATGATAGCACCCTTGTTAGAACCCAC -3 ; Abstart, 5¢-GCGTAGGGTCGACATATGGACGCTGAATT CCGTCACG -3 ; Abstop, 5¢-CCTGCCGAGCTCCTATTA CACAACGCCACCAACCATCAG -3 The PCR solution was prepared in the buffer...
- 16
- 691
- 0
Hepatitis and Liver Cancer: A National Strategy for Prevention and Control of Hepatitis B and C ppt
... report are available from the National Academies Press, 500 Fifth Street, N.W., Lockbox 28 5, Washington, DC 20 055; (800) 6 24 - 6 24 2 or (20 2) 33 4 -33 13 (in the Washington metropolitan area); Internet, ... (accessed August 24 , 20 09) — — 20 09c Notice to readers: National hepatitis b initiative for Asian Americans/Native Hawaiian and other Pacific Islanders Morb Mortal Wkly Rep 58(18):5 03 — — 20 09d Viral ... childhood vaccination rates—Asian and Pacific Islander (API), Hispanic, and African American children have lower vaccination rates than non-Hispanic white children Regarding vaccination of children and...
- 191
- 457
- 0
Hepatitis and Liver Cancer: A National Strategy for Prevention and Control of Hepatitis B and C doc
... Vaccines—therapeutic use—United States WC 536 H5 32 2 20 10] RA 644 .H4H37 20 10 616.99' 43 6 —dc 22 20100 031 94 Additional copies of this report are available from the National Academies Press, 500 Fifth ... Lockbox 28 5, Washington, DC 20 055; (800) 6 24 - 6 24 2 or (20 2) 33 4 -33 13 (in the Washington metropolitan area); Internet, http://www.nap.edu For more information about the Institute of Medicine, visit ... kindergarten in 20 06 20 07), but there is variability in coverage among states Additionally, there are racial and ethnic disparities in childhood vaccination rates—Asian and Pacific Islander (API),...
- 253
- 369
- 0
Báo cáo khóa học: ICAM-1 expression is highly NF-jB-dependent in A549 cells No role for ERK and p38 MAPK docx
... 1-selectin and ICAM-1 in the development of allergic airway in ammation in asthma Pulm Pharmacol Ther 14, 20 3 21 0 28 Yamaya, M & Sasaki, H (20 03) Rhinovirus and asthma Viral Immunol 16, 99–109 29 ... 1055–1065 13 Dhawan, P & Richmond, A (20 02) A novel NF-kappa B-inducing kinase-MAPK signaling pathway up-regulates NF-kappaB activity in melanoma cells J Biol Chem 27 7, 7 920 –7 928 14 Birkenkamp, K.U., ... J Biol Chem 27 3, 32 8 5– 32 9 0 Saccani, S., Pantano, S & Natoli, G (20 02) p38-Dependent marking of in ammatory genes for increased NF-kappa B recruitment Nat Immunol 3, 69–75 Carter, A. B., Knudtson,...
- 7
- 379
- 0
Báo cáo khoa học: A characteristic Glu17 residue of pig carnitine palmitoyltransferase 1 is responsible for the low Km for carnitine and the low sensitivity to malonyl-CoA inhibition of the enzyme docx
... pGEMT–5¢HumanCPT1B as a template in a PCR reaction with primers DH6 73 (5¢-AGCTGAATTC ATGGCGGAAGCTCACCAG -3 ) and DH8 03 (5¢-TCCA CCCATGGTAGCAGAGAAGCAGCTTAAGGGTTTGG CGGA -3 ) The PCR reaction yielded a 42 2 -bp ... Sorensen A & Zammit V (20 02) A novel brain-expressed protein related to carnitine palmitoyltransferase I Genomics 80, 43 3 4 42 Wolfgang MJ, Kurama T, Dai Y, Suwa A, Asaumi M, Matsumoto S, Cha SH, ... determinant of its malonyl-CoA sensitivity J Biol Chem 28 1, 32 9 46 – 32 9 52 22 Shi J, Zhu H, Arvidson DN & Woldegiorgis G (20 00) The first 28 N-terminal amino acid residues of human 21 8 23 24 25 26 27 28 ...
- 9
- 550
- 0
Hepatitis and Liver Cancer: A National Strategy for Prevention and Control of Hepatitis B and C pdf
... Veterans Affairs The National Viral Hepatitis Roundtable Advising the nation / Improving health 500 Fifth Street, NW Washington, DC 20 001 TEL 20 2 .33 4 . 23 52 FAX 20 2 .33 4. 14 12 www.iom.edu The Institute ... Disease and Hepatitis Program, Alaska Native Tribal Health Consortium, Anchorage, Alaska Martín Jose Sepúlveda Vice President, Integrated Health Services, International Business Machines Corporation, ... evaluate innovative outreach and education programs Such programs should be offered in a variety of languages and should be integrated into existing health programs that serve at-risk populations...
- 4
- 404
- 1
Báo cáo khoa học: Colocalization of insulin receptor and insulin receptor substrate-1 to caveolae in primary human adipocytes Cholesterol depletion blocks insulin signalling for metabolic and mitogenic control doc
... diabetes Mol Med 2, 36 7 3 72 ˚ 24 Karlsson, M., Thorn, H., Parpal, S., Stralfors, P & Gustavsson, J (20 02) Insulin induces translocation of glucose transporter 25 26 27 28 29 30 31 32 33 34 35 36 ... FEBS 20 04 24 72 M Karlsson et al (Eur J Biochem 27 1) uptake [9 , 23 , 24 ], and that some of the downstream signalling for enhanced glucose uptake may take place in caveolae [25 ] The role of caveolae in ... NaCl, 4. 7 mM KCl, 2. 5 mM CaCl2, 1 .2 mM MgSO4, 1 .2 mM KH2PO4) containing 20 mM Hepes, pH 7 .40 , 1% (w/v) fatty acid-free bovine serum albumin, 100 nM phenylisopropyladenosine, 0.5 UÆmL)1 adenosine...
- 9
- 424
- 0
Báo cáo khoa học: "Reduced n-gram models for English and Chinese corpora" ppt
... Token 4 ,27 3 Mr 2, 268 he said 1 , 23 1 terms weren’t disclosed the company said 2, 46 9 but 2, 0 52 he says 709 2, 42 2 and 1, 945 but the 6 64 as previously reported 2, 144 the 1,5 03 but Mr 538 he said the says ... 6-grams 7-grams Reduced Model %Improvement of Reduced Model on baseline Trigrams Model size reduction 24 23 1 ,4 42 . 99 39 9.61 24 0. 52 2 02. 59 1 94. 06 191 .91 191 . 23 23 0 .46 4. 18% 11.01 Table Reduced ... says 5 24 a spokesman for 1,918 1 ,3 32 and the 1,660 or 950 says Mr 5 23 the spokesman said 1 , 24 9 said 856 in addition 48 8 as a result however 48 4 earlier this year 1,101 855 and Mr 1,007 while last...
- 7
- 273
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các nguyên tắc biên soạn khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 động cơ điện không đồng bộ một pha thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008