Giải mã phân đoạn a hệ gen các chủng virus GUMBORO phân lập ở việt nam nhằm cung cấp nguồn gen cho nghiên cứu vacxin thế hệ mới

205 7 0
  • Loading ...
1/205 trang
Tải xuống

Thông tin tài liệu

Ngày đăng: 05/05/2019, 09:32

2010VN22372 giáo dục đào tạo Trờng đại học nông nghiệp hà nội Lê thị kim xuyến giải phân đoạn a hệ gen chủng virus gumboro PHÂN LËP ë viÖt nam NH»M cung cÊp nguån gen cho nghiên cứu vaccine hệ Luận án tiến sĩ nông nghiệp Chuyên ngành: Vi sinh vật học thú y M sè : 62 62 50 10 Ng−êi h−íng dÉn khoa học: PGS.TS Lê Thanh Hòa TS Nguyễn Bá Hiên Hà Nội - 2010 LI CAM OAN Tụi xin cam đoan cơng trình nghiên cứu tơi thực Các số liệu kết nêu luận án số liệu đầu tiên, hồn tồn trung thực, chưa cơng bố cơng trình hay tạp chí khác nước nước ngồi Mọi giúp đỡ cảm ơn Các thơng tin, tài liệu trích luận án ñã ñược rõ nguồn gốc Hà Nội, ngày tháng năm 2010 Nghiên cứu sinh Lê Thị Kim Xuyến Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… LỜI CẢM ƠN Tơi xin trân trọng bày tỏ lòng biết ơn sâu sắc đến PGS.TS Lê Thanh Hòa Trưởng phòng Miễn dịch học, Viện Công nghệ sinh học, Viện Khoa học Công nghệ Việt Nam thầy trực tiếp hướng dẫn, tận tình bảo tơi suốt q trình nghiên cứu, học tập hồn thành luận án Tôi xin chân thành cảm ơn TS Nguyễn Bá Hiên - Trưởng Bộ môn Vi sinh vật - Truyền nhiễm, Khoa Thú y, Trường ðại học Nông nghiệp Hà Nội, thầy đồng hướng dẫn, tận tình giúp đỡ tơi suốt thời gian học tập nghiên cứu Tôi xin cảm ơn hỗ trợ kinh phí Bộ Khoa học Cơng nghệ cho đề tài cấp Nhà nước KC.04.29 (2004 - 2006) Tôi xin chân thành cảm ơn: - Tập thể anh chị em Phòng Miễn dịch học - Viện Công nghệ Sinh học nơi tơi cơng tác nơi học tập nghiên cứu, giúp tơi hồn thành cơng việc nghiên cứu - Tập thể thầy giáo Bộ môn Vi sinh vật - Truyền nhiễm, Khoa Thú y, Trường ðại học Nơng nghiệp Hà Nội tạo điều kiện thuận lợi cho tơi thời gian sinh hoạt học tập Bộ môn - TS Nguyễn Bá Thành, PGS.TS ðinh Thị Bích Lân đồng nghiệp giúp đỡ tơi q trình thu thập mẫu bệnh phẩm - Viện ðào tạo Sau ñại học cán phụ trách ñào tạo ñã tạo điều kiện thuận lợi cho tơi suốt thời gian nghiên cứu học tập Cuối muốn bày tỏ lòng biết ơn sâu sắc đến người thân gia đình ln khuyến khích, động viên chia sẻ khó khăn với tơi suốt q trình học tập hồn thành nghiên cứu Xin chân thành cảm ơn Tác giả Lê Thị Kim Xuyến Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… MỤC LỤC Trang Trang phụ bìa Lời cam đoan Mục lục Danh mục ký hiệu, chữ viết tắt Danh mục bảng Danh mục hình vẽ, ñồ thị MỞ ðẦU Chương TỔNG QUAN TÀI LIỆU 1.1 ðẠI CƯƠNG VỀ BỆNH GUMBORO 1.1.1 1.1.2 1.1.3 1.1.4 1.1.5 1.1.6 1.1.7 1.2 SINH HỌC PHÂN TỬ VIRUS GUMBORO 1.2.1 1.2.2 1.2.3 1.2.4 1.2.5 1.2.6 1.3 1.3.2 1.3.3 1.5 Hệ gen virus Gumboro Protein virus - cấu trúc chức Kháng nguyên virus Gumboro Cơ chế phân tử trình nhân lên IBDV………………… Cơ chế phân tử trình “chết theo chương trình” (apoptosis) hậu virus Gumboro gây ra……………… Epitope biến ñổi tính kháng nguyên ñộc lực CÁC CHỈ THỊ DI TRUYỀN PHÂN TỬ TRONG NGHIÊN CỨU VIRUS GUMBORO 1.3.1 1.4 Lịch sử ñịa dư bệnh Nguyên nhân gây bệnh Cơ chế sinh bệnh Triệu chứng lâm sàng Bệnh tích Chẩn đốn bệnh Phòng bệnh Gumboro Phản ứng RT-PCR thông dụng nghiên cứu phân tử virus Gumboro Chỉ thị di truyền sử dụng vùng “siêu biến ñổi” Chỉ thị di truyền sử dụng toàn gen kháng nguyên VP2 TÌNH HÌNH NGHIÊN CỨU SINH HỌC PHÂN TỬ VIRUS GUMBORO VIỆT NAM TẦM QUAN TRỌNG CỦA VIỆC GIẢI HỆ GEN VIRUS GUMBORO Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 4 10 10 13 13 15 16 19 26 28 31 34 40 40 42 43 44 48 Chương NỘI DUNG, VẬT LIỆU VÀ PHƯƠNG PHÁP NGHIÊN CỨU 2.1 NỘI DUNG 2.1.1 2.1.2 2.1.3 Giải trình tự chuỗi nucleotide gen kháng nguyên VP2 phân ñoạn A (VP2-4-3) virus Gumboro phân lập Việt Nam Phân tích so sánh thành phần gen, mối quan hệ nguồn gốc phả hệ chủng Gumboro Việt Nam giới dựa gen phân ñoạn A Phân tích so sánh thành phần gen, mối quan hệ nguồn gốc phả hệ chủng Gumboro Việt Nam giới dựa tồn phân đoạn A 2.2 VẬT LIỆU 2.3 PHƯƠNG PHÁP NGHIÊN CỨU 2.3.1 2.3.2 2.3.3 2.3.4 Phương pháp chọn lấy mẫu Phương pháp tách chiết RNA tổng số Phương pháp RT-PCR Phương pháp kiểm tra sản phẩm RT-PCR ñiện di thạch agarose 2.3.5 Phương pháp tinh sản phẩm RT-PCR 2.3.6 Phương pháp tạo dòng 2.3.7 Phương pháp thu nhận DNA đích sản phẩm PCR/RT-PCR nhiều ñoạn 2.3.8 Phương pháp cắt-nối-ghép DNA 2.3.9 Phương pháp giải trình tự 2.3.10 Phương pháp xử lý số liệu sử dụng phần mềm tin-sinh học CHƯƠNG KẾT QUẢ VÀ THẢO LUẬN 3.1 KẾT QUẢ GIẢI TRÌNH TỰ CHUỖI NUCLEOTIDE GEN KHÁNG NGUYÊN VP2 VÀ PHÂN ðOẠN A (VP2-4-3) 3.1.1 Kết xác ñịnh mẫu bệnh phẩm cung cấp nguồn RNA hệ gen virus 3.1.2 Kết giải trình tự gen kháng nguyên VP2 3.1.3 Kết giải trình tự phân ñoạn A 3.1.3.1 Giải trình tự phân đoạn A chủng BDG23 từ mẫu bệnh phẩm thu nhận Bình Dương 3.1.3.2 Giải trình tự phân đoạn A chủng GHUT-12 từ mẫu bệnh phẩm thu nhận Thừa Thiên-Huế 3.1.3.3 Giải trình tự phân ñoạn A từ chủng cường ñộc cổ ñiển G202 phân lập Hà Nội 3.1.4 Danh sách ñăng ký Ngân hàng gen chủng Gumboro Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 51 51 51 51 52 52 54 55 55 56 57 58 58 63 64 64 66 71 71 71 74 77 78 81 84 86 3.2 PHÂN TÍCH SO SÁNH THÀNH PHẦN GEN, MỐI QUAN HỆ NGUỒN GỐC PHẢ HỆ CỦA CÁC CHỦNG GUMBORO VIỆT NAMTHẾ GIỚI DỰA TRÊN CÁC GEN TRONG PHÂN ðOẠN A 3.2.1 PHÂN TÍCH GEN VP2 89 91 91 3.2.1.1 Về thành phần nucleotide, amino acid 3.2.1.2 Phân tích đồng (về nucleotide) tương ñồng (về amino acid) 96 3.2.1.3 Phân tích mối quan hệ nguồn gốc phả hệ 100 3.2.2 PHÂN TÍCH GEN VP5 103 3.2.2.1 Về thành phần nucleotide amino acid 103 3.2.2.2 Phân tích đồng (về nucleotide) tương đồng (về amino acid) 106 3.2.2.3 Phân tích mối quan hệ nguồn gốc phả hệ sử dụng gen VP5 108 3.2.3 PHÂN TÍCH GEN VP4 109 3.2.3.1 Về thành phần nucleotide amino acid 109 3.2.3.2 Phân tích đồng (về nucleotide) tương ñồng (về amino acid) 112 3.2.3.3 Phân tích mối quan hệ nguồn gốc phả hệ sử dụng gen VP4 113 3.2.4 PHÂN TÍCH GEN VP3 115 3.2.4.1 Về thành phần nucleotide amino acid 115 3.2.4.2 Phân tích đồng (về nucleotide) tương ñồng (về amino acid) 118 3.2.4.3 Phân tích mối quan hệ nguồn gốc phả hệ sử dụng gen VP3 119 3.3 PHÂN TÍCH SO SÁNH THÀNH PHẦN GEN, MỐI QUAN HỆ NGUỒN GỐC PHẢ HỆ CỦA CÁC CHỦNG GUMBORO VIỆT NAMTHẾ GIỚI DỰA TRÊN TOÀN BỘ PHÂN ðOẠN A 121 3.3.1 3.3.2 3.3.3 3.3.4 3.4 Phân tích đặc tính sử dụng nucleotide/amino acid ñể kiến tạo phân ñoạn A (VP2-4-3) chủng BDG23, GHUT-12, G202 Về thành phần nucleotide amino acid Phân tích tỷ lệ ñồng (về nucleotide) tương ñồng (về amino acid) Phân tích mối quan hệ nguồn gốc phả hệ THẢO LUẬN CHUNG KẾT LUẬN VÀ KIẾN NGHỊ DANH MỤC CƠNG TRÌNH CỦA TÁC GIẢ TÀI LIỆU THAM KHẢO PHỤ LỤC Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 121 124 128 130 132 140 142 143 161 DANH MỤC CÁC KÝ HIỆU, CÁC CHỮ VIẾT TẮT Ký hiệu Tiếng Anh Tiếng Việt AGP Agar Gel Precipitation Phản ứng kết tủa khuếch tán thạch bp Base pair Cặp bazơ cDNA complementary DNA DNA bổ sung CEF Chicken Embryo fibroblast Môi trường tế bào xơ phôi gà lớp CEK Chicken Embryo Kidney cells Môi trường tế bào thận thai gà CPE Cytopathic Effect Bệnh tích tế bào cv classical virulent Virus độc tính cổ điển Da dalton DNA Deoxyribonucleic acid Axit Deoxyribonucleic ELISA Enzym Linked Phản ứng hấp phụ miễn dịch liên kết với Immunosorbent Assay enzyme gs group-specific Kháng ngun đặc hiệu theo nhóm IBD Infectious Bursal Disease Bệnh viêm túi Fabricius truyền nhiễm IBDV Infectious Bursal Disease Virus gây viêm túi Fabricius truyền Virus nhiễm INF Interferon kDa kilo dalton m.o.i multiplicity of infection Tỷ lệ gây nhiễm ORF Open Reading Frame Khung ñọc mở RNA Ribonucleic Acid Axit ribonucleic RT-PCR Reverse transcriptase polymerase chain reaction SPF Special Pathogen Free Sạch mầm bệnh ts type-specific Kháng nguyên ñặc hiệu theo týp VN Virus Neutralization Phản ứng trung hòa VP Viral protein Protein virus vvIBDV Very virulent Infectious Virus gây viêm túi Fabricius truyền Bursal Disease Virus nhiễm có độc lực cao Trường ðại học Nơng nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… DANH MỤC CÁC BẢNG Bảng Nội dung Trang 2.1 Danh sách mẫu bệnh phẩm Gumboro sử dụng nghiên cứu 53 2.2 Thành phần phản ứng RT-PCR chu trình nhiệt nghiên cứu sinh học phân tử virus Gumboro 56 Các mồi sử dụng phản ứng RT-PCR giải trình tự nghiên cứu virus Gumboro 57 2.3 3.1 Danh sách quyền ñăng ký gen VP2 phân ñoạn A (VP2-4-3) Ngân hàng gen sử dụng nghiên cứu 87 Danh sách chủng Gumboro Việt Nam giới sử dụng gen phân đoạn A phân tích so sánh thành phần gen mối quan hệ nguồn gốc phả hệ 88 Vị trí sai khác nucleotide (74/178) dẫn ñến sai khác amino acid gen kháng nguyên VP2 (1356 bp) 28 chủng so sánh 93 3.4 55 vị trí sai khác amino acid protein VP2 28 chủng so sánh 94 3.5 Sai khác amino acid vị trí quan trọng có vai trò định tính kháng ngun ñộc lực virus Gumboro chủng Việt Nam giới 95 Tỷ lệ (%) ñồng nucleotide (trên ñường chéo) tương ñồng amino acid (dưới ñường chéo) gen kháng nguyên VP2 chủng Gumboro Việt Nam giới 97 3.2 3.3 3.6 3.7 Tỷ lệ (%) tương ñồng nucleotide (dưới ñường chéo) amino acid (trên ñường chéo) 16 chủng Gumboro nghiên cứu (gen kháng nguyên VP2)……………………………………… 100 3.8 Các vị trí sai khác nucleotide dẫn ñên sai khác amino acid (21 số 28 sai khác) gen hóa cho protein VP5 28 chủng so sánh 104 3.9 20 vị trí sai khác amino acid protein VP5 28 chủng so sánh 3.10 Tỷ lệ (%) ñồng nucleotide (trên ñường chéo) tương ñồng 105 amino acid (dưới ñường chéo) gen VP5 chủng Gumboro Việt Nam giới 107 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nơng nghiệp ……… 3.11 Vị trí sai khác nucleotide (26 số 109) dẫn ñên sai khác amino acid gen VP4 15 chủng 110 3.12 22 vị trí sai khác amino acid protein enzyme VP4 15 chủng 110 3.13 Vị trí sai khác nucleotide amino acid VP4 chủng Âu - Mỹ Châu Á 111 3.14 Tỷ lệ (%) ñồng nucleotide (trên ñường chéo) tương ñồng amino acid (dưới ñường chéo) gen VP4 15 chủng so sánh 112 3.15 Vị trí sai khác nucleotide (36 số 95) dẫn ñến sai khác amino acid gen VP3 15 chủng so sánh 117 3.16 25 vị trí sai khác amino acid protein VP3 15 chủng so sánh 117 3.17 Tỷ lệ (%) ñồng nucleotide (trên ñường chéo) tương ñồng amino acid (dưới ñường chéo) gen VP3 chủng Gumboro Việt Nam giới 118 3.18 Thành phần nucleotide sử dụng VP2-4-3 (3039 nucleotide) phân ñoạn A chủng BDG23, GHUT-12 G202 122 3.19 Thành phần amino acid sử dụng polypeptide chung VP2-4-3 hóa chủng BDG23, GHUT-12 G202 123 3.20 Các vị trí có sai khác nucleotide phân đoạn A có độ dài 3039 bp chủng Gumboro Việt Nam, theo trật tự gen VP2-VPx-VP4-VP3 126 3.21 Các vị trí sai khác amino acid protein chung phân ñoạn A chủng Gumboro Việt Nam giới, theo trật tự phân bố VP2-VPx-VP4-VP3 127 3.22 Tỷ lệ (%) ñồng nucleotide (trên ñường chéo) tương ñồng amino acid (dưới ñường chéo) VP2-4-3 chủng Gumboro Việt Nam giới (Âu-Mỹ Châu Á) 129 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 10 DANH MỤC CÁC HÌNH Hình Nội dung 1.1 Vùng Gumboro, địa hạt Sussex bang Delaware Mỹ, nơi ñầu tiên phát bệnh Gumboro 1.2 Cấu trúc hạt IBDV kính hiển vi ñiện tử 1.3 Virus Gumboro thường tập hợp thành cụm nằm tế bào lympho B bị nhiễm 1.4 Bệnh tích túi Fabricius hệ 11 1.5 Ảnh vi thể tế bào ñại thực bào túi Fabricius bị virus Gumboro công 12 1.6 Các hạt virus nhìn kính hiển vi điện tử 15 1.7 Hệ gen virus Gumboro bao gồm phân đoạn A B nhìn kính vi điện tử 17 1.8 Sơ ñồ hệ gen số vùng quan trọng IBDV serotype I II 18 1.9 Các phân ñoạn A B hệ gen virus Gumboro qua ñiện di DNA thành phần protein qua ñiện di protein 20 Sơ ñồ minh hoạ hệ gen virus Gumboro trình tổng hợp protein cấu trúc 24 Quy luật biến ñổi epitope: cường ñộc -> ñộc lực yếu -> nhược ñộc ngược lại 36 1.12 Sơ ñồ minh họa bước chu kỳ phản ứng PCR 42 2.1 Sơ ñồ nghiên cứu tổng quát ñể thu nhận chuỗi gen……… 55 1.10 1.11 Trang ® 2.2 Cấu trúc vector pCR 2.1TOPO (Invitrogen)…………………… 59 2.3 Quy trình tách chiết plasmid tái tổ hợp…………………………… 61 3.1 Sơ ñồ minh họa vùng “siêu biến ñổi” hệ gen IBDV vị trí bám cặp mồi GF-GR…………………………………………………… 72 Kết ñiện di kiểm tra RNA tổng số, sản phẩm RT-PCR sử dụng cặp mồi GF-GR……………………………………………… 72 Kết ñiện di kiểm tra sản phẩm DNA plasmid tái tổ hợp enzyme EcoRI……………………………………………………… 73 Giản đồ (chromatogram) phần trình tự vùng “siêu biến ñổi” gen kháng nguyên VP2 chủng BDG………………………………… 74 3.2 3.3 3.4 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 11 52-70 Cu1 D78 CS-2-35 GLS STC IM VX2512 VXBL GSG4 GSG16 GHY BDG23 GTN GTG25 GTG GT1ST GPT GLL2 GHUT1 GHUT-12 G202 BDG HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : : : : : : : : : : : : : : 780 * 800 * 820 * 840 * 860 * 880 GGGCGCCACCATCTACCTCATAGGCTTTGATGGGACAGCGGTAATCACCAGGGCTGTGGCCGCAAACAGTGGGCTGACGACCGGCACCGACAACCTTTTGCCATTCAATC .A T .A A A G A A A T .T.T T A A G T A T.T .TA G A G T A T .C G A G T A T .TA G A G T A A T .TA G A G T A A T .TA G A G T A A T .TA G A G T A A T .TA G AC .G T A A T .TA G A G T A A T T C T A G A A G .T .A C A T C T A A G A A G .A A T .T C T A A G A A G .A A T C T A G A A G .T .A A T T C T A G A A G .T .A A G T C A T A A G A A G T T .A A T T C T A G A A G .T .A A T T C T A G A A G .T .A A T T C T A G A A G .T .A A T T .T A G A A G .T .A A T T T .T A G A A G .T .A CA T T T .T A A A G .T .A A T T T .T A G A A G .T .A A T T T .T A G A A G .T .A A T T T.A A G A A T .A A : : : : : : : : : : : : : : : : : : : : : : : : : : : : 880 880 880 880 880 880 880 880 880 880 880 880 880 880 880 880 880 880 880 880 880 880 880 880 880 880 880 880 52-70 Cu1 D78 CS-2-35 GLS STC IM VX2512 VXBL GSG4 GSG16 GHY BDG23 GTN GTG25 GTG GT1ST GPT GLL2 GHUT1 GHUT-12 G202 BDG HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : : : : : : : : : : : : : : * 900 * 920 * 940 * 960 * 980 * TTGTGATTCCAACAAACGAGATAACCCAGCCAATCACATCCATCAAACTGGAGATAGTGACCTCCAAAAGTGGTGGTCAGGCAGGGGATCAGATGTCATGGTCCGCAAGA T G A G C A C T .C .G C G T .C C G T .C T .C C G T .C T .C C G T .C T .C C G T .C T G C C G T .C T .C C G T .C T A T .C.G T .G A T .C.G T .G C A T .C.G T .G C A T .C.G T .G A T .C.G T .G A T .C.G G C .G A T .C.G T .G A A T .C.G T .G A A T .C.G T .G A T .C.G T A T .C.G G A T .C.G G A T .C.G G A T .C.G A .G CA A T .C.G G A T : : : : : : : : : : : : : : : : : : : : : : : : : : : : 990 990 990 990 990 990 990 990 990 990 990 990 990 990 990 990 990 990 990 990 990 990 990 990 990 990 990 990 52-70 Cu1 D78 CS-2-35 GLS STC IM VX2512 VXBL GSG4 GSG16 GHY BDG23 GTN GTG25 GTG GT1ST GPT GLL2 GHUT1 GHUT-12 G202 BDG HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : : : : : : : : : : : : : : 1000 * 1020 * 1040 * 1060 * 1080 * 1100 GGGAGCCTAGCAGTGACGATCCATGGTGGCAACTATCCAGGGGCCCTCCGTCCCGTCACGCTAGTGGCCTACGAAAGAGTGGCAACAGGATCCGTCGTTACGGTCGCTGG T A A T C A A .A A .A A .A A .A A .A A .A A C C T A A .T T C C C .A A .T T -CT C A A T T T C C A A T T T C C A A .T T C C A A .T G T C C .C A A .T G T C C A A .T G T C C A A .T G T C C A A .T A C C C T A A .T T C C A C .A A .G T C C A A T C C C .A A .G T C C A A T C C A A T C : : : : : : : : : : : : : : : : : : : : : : : : : : : : 1100 1100 1100 1100 1100 1100 1100 1100 1100 1100 1100 1100 1100 1099 1100 1100 1100 1100 1100 1100 1100 1100 1100 1100 1100 1100 1100 1100 52-70 Cu1 D78 CS-2-35 GLS STC IM VX2512 VXBL GSG4 GSG16 GHY BDG23 GTN GTG25 GTG GT1ST GPT GLL2 GHUT1 GHUT-12 G202 BDG HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : : : : : : : : : : : : : : * 1120 * 1140 * 1160 * 1180 * 1200 * GGTGAGCAACTTCGAGCTGATCCCAAATCCTGAACTAGCAAAGAACCTGGTTACAGAATACGGCCGATTTGACCCAGGAGCCATGAACTACACAAAATTGATACTGAGTG G G.G A.C G .A.C T .A.C A.C A.C C A.C G G .A.C A.C A.C T C T .A.C G .C G .C T .C G .C .C : : : : : : : : : : : : : : : : : : : : : : : : : : : : 1210 1210 1210 1210 1210 1210 1210 1210 1210 1210 1210 1210 1210 1209 1210 1210 1210 1210 1210 1210 1210 1210 1210 1210 1210 1210 1210 1210 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 181 52-70 Cu1 D78 CS-2-35 GLS STC IM VX2512 VXBL GSG4 GSG16 GHY BDG23 GTN GTG25 GTG GT1ST GPT GLL2 GHUT1 GHUT-12 G202 BDG HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : : : : : : : : : : : : : : 1220 * 1240 * 1260 * 1280 * 1300 * 1320 AGAGGGACCGTCTTGGCATCAAGACCGTCTGGCCAACAAGGGAGTACACTGACTTTCGTGAATACTTCATGGAGGTGGCCGACCTCAACTCTCCCCTGAAGATTGCAGGA C A G C G .G .C G T C G T C G T C G T C G T .G T C G T A A C G T A C G G G A C C C G .T A C C C G .T A C G T A C C G T A C G T A C G T A C G A C G A C G A C G .A C G A C G A C G C G 52-70 Cu1 D78 CS-2-35 GLS STC IM VX2512 VXBL GSG4 GSG16 GHY BDG23 GTN GTG25 GTG GT1ST GPT GLL2 GHUT1 GHUT-12 G202 BDG HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : : : : : : : : : : : : : : * 1340 * GCATTCGGCTTCAAAGACATAATCCGGGCCATAAGG A T T T T T T T T T .T T T T T T T T T .T T .T C .T T G T AC .T C .T .T C .T C .T T 52-70 Cu1 D78 CS-2-35 GLS STC IM VX2512 VXBL GSG4 GSG16 GHY BDG23 GTN GTG25 GTG GT1ST GPT GLL2 GHUT1 GHUT-12 G202 BDG HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : : : : : : : : : : : : : : 52-70 Cu1 D78 CS-2-35 GLS STC IM VX2512 VXBL GSG4 GSG16 GHY BDG23 GTN GTG25 GTG GT1ST GPT GLL2 GHUT1 GHUT-12 G202 BDG HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : 1320 1320 1320 1320 1320 1320 1320 1320 1320 1320 1320 1320 1320 1319 1320 1320 1320 1320 1320 1320 1320 1320 1320 1320 1320 1320 1320 1320 * 20 * 40 * 60 * 80 * 100 * MTNLQDQTQQIVPFIRSLLMPTTGPASIPGDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGAHYTLQSNGNYKFDQMLLTAQNLPASYNYCRLVSRSLTVRS .D .D .D .D .D .L D P D .D .D .A A .V .D P P D P D S .D .D .D .D .D P G .D .D .D P D .D .D .D .D .D .D : : : : : : : : : : : : : : : : : : : : : : : : : : : : 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 120 * 140 * 160 * 180 * 200 * 220 STLPGGVYALNGTINAVTFQGSLSELTDVSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMVATCDSSDRPRVYTITAADDYQFSSQY I L L S V L L .R I L I L .N .N .N .N .E .N I A N I N .E .N R E .N .N : : : : : : : : : : : : : : : : : : : : : : : : : : : : 220 220 220 220 220 220 220 220 220 220 220 220 220 220 220 220 220 220 220 220 220 220 220 220 220 220 220 220 b Amino acid : : : : : : : : : : : : : : : : : : : : : : : : : : : : 1356 1356 1356 1356 1356 1356 1356 1356 1356 1356 1356 1356 1356 1355 1356 1356 1356 1356 1356 1356 1356 1356 1356 1356 1356 1356 1356 1356 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 182 52-70 Cu1 D78 CS-2-35 GLS STC IM VX2512 VXBL GSG4 GSG16 GHY BDG23 GTN GTG25 GTG GT1ST GPT GLL2 GHUT1 GHUT-12 G202 BDG HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : : : : : : : : : : : : : : * 240 * 260 * 280 * 300 * 320 * QPGGVTITLFSANIDAITSLSVGGELVFQTSVHGLVLGATIYLIGFDGTAVITRAVAANSGLTTGTDNLLPFNLVIPTNEITQPITSIKLEIVTSKSGGQAGDQMSWSAR T .N .M S K N Q .AT .N .M T K QS S N A M E S Q .F T DN A M V .S .I Q .DN A M .S Q T DN A M I S Q T DN A M I S Q T DN A M I S Q T DN A M I G S Q T DN A M I S Q T DN A M I S A I Q I DN A M.L.I S S A I T Q I DN A M I S S A I T Q I F .DN A M I S S A I Q I DN A M I S S A I Q I DN A M I S S AD I Q I DN A M I S R S A I Q I DN A M I S .N S A I Q I DN A M I S .N S A I Q I DN A M I S S A I Q I DN A M I S S A I Q I DN A M I S S A I Q I .N A M I S S A I Q I DN A M I S S A I Q I DN A M I S K S A I I E DN .M I S S : : : : : : : : : : : : : : : : : : : : : : : : : : : : 330 330 330 330 330 330 330 330 330 330 330 330 330 330 330 330 330 330 330 330 330 330 330 330 330 330 330 330 52-70 Cu1 D78 CS-2-35 GLS STC IM VX2512 VXBL GSG4 GSG16 GHY BDG23 GTN GTG25 GTG GT1ST GPT GLL2 GHUT1 GHUT-12 G202 BDG HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : : : : : : : : : : : : : : 340 * 360 * 380 * 400 * 420 * 440 GSLAVTIHGGNYPGALRPVTLVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERDRLGIKTVWPTREYTDFREYFMEVADLNSPLKIAG S V E I -W I V G I .I .I .I C L A I .I .I .I : : : : : : : : : : : : : : : : : : : : : : : : : : : : 440 440 440 440 440 440 440 440 440 440 440 440 440 439 440 440 440 440 440 440 440 440 440 440 440 440 440 440 52-70 Cu1 D78 CS-2-35 GLS STC IM VX2512 VXBL GSG4 GSG16 GHY BDG23 GTN GTG25 GTG GT1ST GPT GLL2 GHUT1 GHUT-12 G202 BDG HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : : : : : : : : : : : : : : * AFGFKDIIRAIR L L L L L L L L : : : : : : : : : : : : : : : : : : : : : : : : : : : : 452 452 452 452 452 452 452 452 452 452 452 452 452 451 452 452 452 452 452 452 452 452 452 452 452 452 452 452 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 183 Phụ lục 6: SO SÁNH TRÌNH TỰ THÀNH PHẦN AMINO ACID VP5 GIỮA CÁC CHỦNG GUMBORO VIỆT NAMTHẾ GIỚI (Dấu (.) biểu thị giống với amino acid chủng 52-70; sai khác chủng so với chủng 52-70 biểu thị ký hiệu chữ (1 chữ cái) chúng) (phần bơi đậm 16 chuỗi nghiên cứu này) 52-70D0086 Cu1D00867G D78AF49992 CS-2-35EF4 GLSAY36865 STCD00499U IMAY029166 VX2512DQ35 VXBLDQ3558 GSG4AY8419 GSG16AY841 GHYVIETNAM BDG23VIETN GTNVIETNAM GTG25DQ355 GTGVIETNAM GT1STDQ355 GPTVIETNAM GLL2DQ3558 GHUT1AY841 GHUT-12DQ7 G202VIETNA BDGDQ35581 HK46AF0929 SH-92AF533 OKYMD49706 Harbin-1AF NBEU595669 : : : : : : : : : : : : : : : : : : : : : : : : : : : : * 20 * 40 * 60 * 80 * 100 * DKPARSNPTDCSVHTEPSDANNRTGVHSGRHPGEAHSQVRDLDLQFDCGGHRVRANCLFPWIPWLNCGCSLHTAEQWELQVRSDAPDCPEPTGQLQLLQASESESHSEVKH .K P .A G .A A R F R F R F R.T F R R F R R R F R R F R R F R A R F R F .E R F R F .E R F .E R F .G .Y R F S .Y 52-70D0086 Cu1D00867G D78AF49992 CS-2-35EF4 GLSAY36865 STCD00499U IMAY029166 VX2512DQ35 VXBLDQ3558 GSG4AY8419 GSG16AY841 GHYVIETNAM BDG23VIETN GTNVIETNAM GTG25DQ355 GTGVIETNAM GT1STDQ355 GPTVIETNAM GLL2DQ3558 GHUT1AY841 GHUT-12DQ7 G202VIETNA BDGDQ35581 HK46AF0929 SH-92AF533 OKYMD49706 Harbin-1AF NBEU595669 : : : : : : : : : : : : : : : : : : : : : : : : : : : : 120 * TSWWRLCTKRHHKRRDLPRKPE P P P P P P P P P .E P I N P I N P I N P I N P I N I N P I N P I N P N P I N P .W P .W P .W P .W P .W - : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 133 133 133 133 133 133 133 133 133 133 133 133 133 133 133 133 133 133 133 133 133 133 133 133 133 133 133 133 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 184 Phụ lục 7: SO SÁNH TRÌNH TỰ THÀNH PHẦN NUCLEOTIDE VÀ AMINO ACID GEN HÓA CHO ENZYM VP4 GIỮA CÁC CHỦNG GUMBORO VIỆT NAMTHẾ GIỚI (Dấu (.) biểu thị giống với nucleotide/amino acid chủng 52-70; sai khác chủng so với chủng 52-70 biểu thị ký hiệu nuleotide/chữ (1 chữ cái) chúng) (phần bơi đậm chuỗi nghiên cứu này) a Nucleotide 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 20 * 40 * 60 * 80 * 100 * GCCGACAAGGGGTACGAGGTAGTCGCGAATCTATTCCAGGTGCCCCAGAATCCCGTAGTCGACGGGATTCTTGCTTCACCTCGGGTACTCCGCGGTGCACACAACCTCGA G A .G .G CG A .A .G C A .A .G G T .G T .T G T C .G A C A G T T T .C .G A C G T T C .G A T G T .T G A G T .T .C .G A G T .T .C .G A A .G T C .G A G T .T .C .G A : : : : : : : : : : : : : : : 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 120 * 140 * 160 * 180 * 200 * 220 CTGCGTGTTAAGAGAGGGTGCCACGCTATTCCCTGTGGTTATTACGACAGTGGAAGACGCCATGACACCCAAAGCATTGAACAGCAAAATGTTTGCTGTCATTGAAGGCG C C C .C.A C C .A T C C .C.G C C T C .G C C T C .G C C T C .G C C T C .G C C T C .G C C T C .G C C T C .G C C T C : : : : : : : : : : : : : : : 220 220 220 220 220 220 220 220 220 220 220 220 220 220 220 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 240 * 260 * 280 * 300 * 320 * TGCGAGAAGACCTCCAACCTCCTTCTCAAAGAGGATCCTTCATACGAACTCTCTCTGGACACAGAGTCTATGGATATGCTCCAGGTGGGGTACTTCCACTGGAGACTGGG A A A A A A G A C A A G C A A A G C A A C C T A G A C T A A TT A C G T A A T A C T A T A A C T A A C T A T A C T A T A C T A A : : : : : : : : : : : : : : : 330 330 330 330 330 330 330 330 330 330 330 330 330 330 330 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 340 * 360 * 380 * 400 * 420 * 440 AGAGACTACACCGTTGTCCCAATAGATGATGTCTGGGACGACAGCATTATGCTGTCCAAAGATCCCATACCTCCCATTGTGGGAAACAGTGGAAATCTAGCCATAGCTTA T T T C T C T .T G C T .T C T G .T .C T C C C .T G .C C C C .T G C C T C C T G .C T C CC T G .C T C C Y T T G .C T G C C T G G C T C T G .T .C C C A : : : : : : : : : : : : : : : 440 440 440 440 440 440 440 440 440 440 440 440 440 440 440 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 460 * 480 * 500 * 520 * 540 * CATGGATGTGTTTCGACCCAAAGTCCCAATCCATGTGGCTATGACGGGAGCCCTCAATGCTTGTGGCGAGATTGAGAAAGTAAGCTTTAGAAGCACCAAGCTCGCCACTG T .C C .C A C T C C A T .C C A C C .C C.A .C G .C C .C C.A .T G .A .C C C .C C.A .C G .C C .C C.A .C G .T V A T C G C C.A .C G .A .C A C .C C.A .C G .C C .C C.A .C G .C C .C C.A .C G : : : : : : : : : : : : : : : 550 550 550 550 550 550 550 550 550 550 550 550 550 550 550 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 185 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 560 * 580 * 600 * 620 * 640 * 660 CACACCGACTTGGCCTTAAGTTGGCTGGTCCCGGAGCATTCGATGTAAACACCGGGCCCAACTGGGCAACGTTCATCAAACGTTTCCCTCACAATCCACGCGACTGGGAC G .G C .T C C C G C C C .T T C G G T G T T C .T T C G .T G T T C .T T C G .T G T C T T T C G .T G T T C C .T T C G .T G T T C .T T C G .T G T T C .T T C G .T G T T C .T C T C G .T G .T G 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 680 * 700 * 720 AGGCTCCCCTACCTCAACCTACCATACCTTCCACCCAATGCAGGGCGCCAGTACCACCTTGCCATGGCT A A A T .A C C T .A T .A T T C A .G G C TT A .G G C T T T A .G G C T T .A .G G C T T .A .G G C T T .C A .G G C T T .A .G G T C T .A .G G C : : : : : : : : : : : : : : : : : : : : : : : : : : : : : : 660 660 660 660 660 660 660 660 660 660 660 660 660 660 660 729 729 729 729 729 729 729 729 729 729 729 729 729 729 729 b Amino acid 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 20 * 40 * 60 * 80 * 100 * ADKGYEVVANLFQVPQNPVVDGILASPRVLRGAHNLDCVLREGATLFPVVITTVEDAMTPKALNSKMFAVIEGVREDLQPPSQRGSFIRTLSGHRVYGYAPGGVLPLETG G .D G .D G .D G .D G .D H G .K .D G .D G .D G .F .D G .D G .D G .D T G .D G .D .R : : : : : : : : : : : : : : : 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 120 * 140 * 160 * 180 * 200 * 220 RDYTVVPIDDVWDDSIMLSKDPIPPIVGNSGNLAIAYMDVFRPKVPIHVAMTGALNACGEIEKVSFRSTKLATAHRLGLKLAGPGAFDVNTGPNWATFIKRFPHNPRDWD F .Y N A.S .Y N S .Y N S T .Y N S - - .Y N S .Y N S .Y N S .Y N S R : : : : : : : : : : : : : : : 220 220 220 220 220 220 220 220 220 220 220 218 220 220 220 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 240 RLPYLNLPYLPPNAGRQYHLAMA D S D .F D D D D D D : : : : : : : : : : : : : : : 243 243 243 243 243 243 243 243 243 243 243 241 243 243 243 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 186 Phụ lục 8: SO SÁNH TRÌNH TỰ THÀNH PHẦN NUCLEOTIDE VÀ AMINO ACID GEN HÓA CHO PROTEIN VP3 GIỮA CÁC CHỦNG GUMBORO VIỆT NAMTHẾ GIỚI (Dấu (.) biểu thị giống với nucleotide/amino acid chủng 52-70; sai khác chủng so với chủng 52-70 biểu thị ký hiệu nuleotide/chữ (1 chữ cái) chúng) (phần bơi đậm chuỗi nghiên cứu này) a Nucleotide 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 20 * 40 * 60 * 80 * 100 * GCATCAGAGTTCAAAGAGACCCCCGAACTCGAGAGTGCCGTCAGAGCAATGGAAGCAGCAGCCAACGTGGACCCACTATTCCAATCTGCACTCAGTGTGTTCATGTGGCT G T C G C GT A G .T C C G T C C T C T T G G C C A .G C G C G C T C C G G C T C C G G C T G C C G C G C T C C G G C T A .C C G T G T G G C : : : : : : : : : : : : : : : 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 120 * 140 * 160 * 180 * 200 * 220 GGAAGGGAATGGGATTGTGACTGACATGGCCAACTTCGCACTCAGCGACCCGAACGCCCATCGGGTGCGAAATTTTCTTGCAAACGCACCACAAGCAGGCAGCAAGTCGC .A A .A A .A A .A A .C T T A .C A .A .C A G A .C T .T T A A C C A T G.T T .A T C C A T .A C C G .A T .T A C C A T .A C C A T T .A C C AA C A C C A T .A C C : : : : : : : : : : : : : : : 220 220 220 220 220 220 220 220 220 220 220 220 220 220 220 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 240 * 260 * 280 * 300 * 320 * AAAGGGCCAAGTACGGGACAGCAGGCTACGGAGTGGAGGCTCGGGGCCCCACACCAGAGGAAGCACAGAGGGAAAAAGACACACGGATCTCAAAGAAGATGGAGACCATG A C .A C .C .C C .T C.A A C T G G A G T T G T A C T T A C T T A C T A A C T T G.T A C T G .T A C T A .T : : : : : : : : : : : : : : : 330 330 330 330 330 330 330 330 330 330 330 330 330 330 330 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 340 * 360 * 380 * 400 * 420 * 440 GGCATCTACTTTGCAACACCAGAATGGGTAGCACTCAATGGGCACCGAGGGCCAAGCCCCGGCCAGCTAAAGTACTGGCAGAACACACGAGAAATACCGGACCCAAACGA G.C .G T T T .G .G T T .G T T C G G T T A G T T .G T T .G G T T .G T T : : : : : : : : : : : : : : : 440 440 440 440 440 440 440 440 440 440 440 440 440 440 440 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 460 * 480 * 500 * 520 * 540 * GGACTATCTAGACTACGTGCATGCAGAGAAGAGCCGGTTGGCATCAGAAGAACAAATCCAAAGGGCAGCTACGTCGATCTACGGGGCTCCAGGACAGGCAGAGCCACCCC T .T .T .T TT A .T A C T C T .T C T G C T G C T C T C T C T : : : : : : : : : : : : : : : 550 550 550 550 550 550 550 550 550 550 550 550 550 550 550 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 187 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 560 * 580 * 600 * 620 * 640 * 660 AAGCTTTCATAGACGAAGTTGCCAAAGTCTATGAAATCGACCATGGACGTGGCCCAAACCAAGAACAGATGAAAGATCTGCTCTTGACTGCGATGGAGATGAAGCATCGC A A .G A A .A A .G C C A .G C C T .A .G C .G C C A .G C G .T G C C T .A .G C T G G C T G C A .G C .G C C A .G C .C .G C C A .G C C C A .G C .G C C T .A .G C : : : : : : : : : : : : : : : 660 660 660 660 660 660 660 660 660 660 660 660 660 660 660 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 680 * 700 * 720 * 740 * 760 * AATCCCAGGCGGGCTCTACCAAAGCCCAAGCCAAAACCCAATGCTCCAACACAGAGACCCCCTGGTCGGCTGGGCCGCTGGATCAGAACCGTCTCTGATGAGGACCTTGA G .T G G G C .G C G G T C G T C G T C T GG.T C GG.T C T GG.T C T .T GG.T C T GG.T C T GG.T C T GG.T C T GG.T : : : : : : : : : : : : : : : 770 770 770 770 770 770 770 770 770 770 770 770 770 770 770 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : GTGA : : : : : : : : : : : : : : : 774 774 774 774 774 774 774 774 774 774 774 774 774 774 774 b Amino acid 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 20 * 40 * 60 * 80 * 100 * ASEFKETPELESAVRAMEAAANVDPLFQSALSVFMWLEGNGIVTDMANFALSDPNAHRVRNFLANAPQAGSKSQRAKYGTAGYGVEARGPTPEEAQREKDTRISKKMETMG E E E .S E E A E E F K E F E E .G E E .V A .H E E : : : : : : : : : : : : : : : 111 111 111 111 111 111 111 111 111 111 111 111 111 111 111 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 120 * 140 * 160 * 180 * 200 * 220 IYFATPEWVALNGHRGPSPGQLKYWQNTREIPDPNEDYLDYVHAEKSRLASEEQIQRAATSIYGAPGQAEPPQAFIDEVAKVYEIDHGRGPNQEQMKDLLLTAMEMKHRNP .L L L L .A L L L .S L L R H L L P .L L L : : : : : : : : : : : : : : : 222 222 222 222 222 222 222 222 222 222 222 222 222 222 222 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 240 * RRALPKPKPKPNAPTQRPPGRLGRWIRTVSDEDLE P P P P V A P .A P V A P V A P V A P V A P V A P V A .- : : : : : : : : : : : : : : : 257 257 257 257 257 257 257 257 257 257 257 257 257 257 257 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 188 Phụ lục 9: SO SÁNH TRÌNH TỰ NUCLEOTIDE VÀ AMINO ACID PHÂN ðOẠN A (VP2-4-3) CỦA CÁC CHỦNG VIRUS GUMBORO VIỆT NAMTHẾ GIỚI (Dấu (.) biểu thị giống với nucleotide/amino acid chủng 52-70; sai khác chủng so với chủng 52-70 biểu thị ký hiệu nuleotide/chữ (1 chữ cái) chúng) (phần bơi đậm chuỗi nghiên cứu này) a Nucleotide 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 20 * 40 * 60 * 80 * 100 * ATGACAAACCTGCAAGATCAAACCCAACAGATTGTTCCGTTCATACGGAGCCTTCTGATGCCAACAACCGGACCGGCGTCCATTCCGGGCGACACCCTGGAGAAGCACAC A A A A A A C .A C .A .A C C .A .A .G A .A A .A .G A .A .G A .A A .A : : : : : : : : : : : : : : : 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 120 * 140 * 160 * 180 * 200 * 220 TCTCAGGTCAGAGACCTCGACCTACAATTTGACTGTGGGGGACACAGGGTCAGGGCTAATTGTCTTTTTCCCTGGATTCCCTGGCTCAATTGTGGGTGCTCACTACACAC C .T .T .T .T .T .T .T : : : : : : : : : : : : : : : 220 220 220 220 220 220 220 220 220 220 220 220 220 220 220 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 240 * 260 * 280 * 300 * 320 * TGCAGAGCAATGGGAACTACAAGTTCGATCAGATGCTCCTGACTGCCCAGAACCTACCGGCCAGTTACAACTACTGCAGGCTAGTGAGTCGGAGTCTCACAGTGAGGTCA C A .CT C C C C C G C T A C : : : : : : : : : : : : : : : 330 330 330 330 330 330 330 330 330 330 330 330 330 330 330 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 340 * 360 * 380 * 400 * 420 * 440 AGCACACTTCCTGGTGGCGTTTATGCACTAAACGGCACCATAAACGCCGTGACCTTCCAAGGAAGCCTGAGTGAACTGACAGATGTTAGCTACAATGGGTTGATGTCTGC C C A C C G C T .A C A C .T C .T C .T C .T T C .T : : : : : : : : : : : : : : : 440 440 440 440 440 440 440 440 440 440 440 440 440 440 440 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 460 * 480 * 500 * 520 * 540 * AACAGCCAACATCAACGACAAAATTGGGAACGTCCTAGTAGGGGAAGGGGTCACCGTCCTCAGCTTACCCACATCATATGATCTTGGGTATGTGAGGCTTGGTGACCCCA T T T T G T T G C A T G A C .G C .A A T G A C C A A C C A A C C A A C C A A C C G A C : : : : : : : : : : : : : : : 550 550 550 550 550 550 550 550 550 550 550 550 550 550 550 52-70 Cu1 D78 CS-2-35 : : : : 560 * 580 * 600 * 620 * 640 * 660 TTCCCGCAATAGGGCTTGACCCAAAAATGGTAGCCACATGTGACAGCAGTGACAGGCCCAGAGTCTACACCATAACTGCAGCCGATGATTACCAATTCTCATCACAGTAC : : : : 660 660 660 660 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 189 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : A T A .T .T .C .T A T T A G A A T A G A A T C .A .T C .A .T C .A .T C .A .T C .A : : : : : : : : : : : 660 660 660 660 660 660 660 660 660 660 660 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 680 * 700 * 720 * 740 * 760 * CAACCAGGTGGGGTAACAATCACACTGTTCTCAGCCAACATTGATGCCATCACAAGCCTCAGCGTTGGGGGAGAGCTCGTGTTTCAAACAAGCGTCCATGGCCTTGTACT C C A A C A AA T A T .T T A A .T .T A G .A G A T C T A.C A .A A .G .A G A T C T A.C A .A A .G .T T C A.C A .A A .G .A .T T C A.C A .A A .G .T T C A.C A .A CA .G .T T C T A.C A .A A .G .A .T T C A.C A .C A : : : : : : : : : : : : : : : 770 770 770 770 770 770 770 770 770 770 770 770 770 770 770 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 780 * 800 * 820 * 840 * 860 * 880 GGGCGCCACCATCTACCTCATAGGCTTTGATGGGACAGCGGTAATCACCAGGGCTGTGGCCGCAAACAGTGGGCTGACGACCGGCACCGACAACCTTTTGCCATTCAATC .A T .A A A G A A A T .T.T T A A G T A T.T .TA G A G T A T .C G A G T A T .TA G A G T A A T T C T A G A A G .T .A A T T C T A G A A G .T .A A T T T .T A G A A G .T .A CA T T T .T A A A G .T .A A T T T .T A G A A G .T .A A T T T .T A G A A G .T .A A T T T.A A G A A T .A A : : : : : : : : : : : : : : : 880 880 880 880 880 880 880 880 880 880 880 880 880 880 880 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 900 * 920 * 940 * 960 * 980 * TTGTGATTCCAACAAACGAGATAACCCAGCCAATCACATCCATCAAACTGGAGATAGTGACCTCCAAAAGTGGTGGTCAGGCAGGGGATCAGATGTCATGGTCCGCAAGA T G A G C A C T .C .G C G T .C C G T .C T A T .C.G T .G A A T .C.G T .G A T .C.G G A T .C.G G A T .C.G G A T .C.G A .G CA A T .C.G G A T : : : : : : : : : : : : : : : 990 990 990 990 990 990 990 990 990 990 990 990 990 990 990 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 1000 * 1020 * 1040 * 1060 * 1080 * 1100 GGGAGCCTAGCAGTGACGATCCATGGTGGCAACTATCCAGGGGCCCTCCGTCCCGTCACGCTAGTGGCCTACGAAAGAGTGGCAACAGGATCCGTCGTTACGGTCGCTGG T A A T C A A .A A C C T A A .T T C C A A .T G T C C A A .T A C C C A C .A A .G T C C A A T C C C .A A .G T C C A A T C C A A T C : : : : : : : : : : : : : : : 1100 1100 1100 1100 1100 1100 1100 1100 1100 1100 1100 1100 1100 1100 1100 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 1120 * 1140 * 1160 * 1180 * 1200 * GGTGAGCAACTTCGAGCTGATCCCAAATCCTGAACTAGCAAAGAACCTGGTTACAGAATACGGCCGATTTGACCCAGGAGCCATGAACTACACAAAATTGATACTGAGTG A.C G .A.C T C T .C G .C T .C G .C .C : : : : : : : : : : : : : : : 1210 1210 1210 1210 1210 1210 1210 1210 1210 1210 1210 1210 1210 1210 1210 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 190 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 1220 * 1240 * 1260 * 1280 * 1300 * 1320 AGAGGGACCGTCTTGGCATCAAGACCGTCTGGCCAACAAGGGAGTACACTGACTTTCGTGAATACTTCATGGAGGTGGCCGACCTCAACTCTCCCCTGAAGATTGCAGGA C A G C G .G .C G T C G T A C G T A C G A C G A C G .A C G A C G A C G C G 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 1340 * * 1380 * 1400 * 1420 * GCATTCGGCTTCAAAGACATAATCCGGGCCATAAGGAGGATAGCTGTGCCGGTGGTCTCCACATTGTTCCCACCTGCCGCTCCCCTAGCCCATGCAATTGGGGAAGGTGT A .T G T T G T T G T .T T C G T .T T C C T G T C C .T G T AC T C C .T C T C C .T .T C T C C .T C .A T C .T T T C C 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 1320 1320 1320 1320 1320 1320 1320 1320 1320 1320 1320 1320 1320 1320 1320 : : : : : : : : : : : : : : : 1430 1430 1430 1430 1430 1430 1430 1430 1430 1430 1430 1430 1430 1430 1430 1440 * 1460 * 1480 * 1500 * 1520 * AGACTACCTGCTGGGCGATGAGGCACAGGCTGCTTCAGGAACTGCTCGAGCCGCGTCAGGAAAAGCAAGAGCTGCCTCAGGCCGCATAAGGCAGCTGACTCGCGCCGCCG .T .T .T .T G .T .T .T A T A C.T T T A T A G A T .C A T A T A T A T : : : : : : : : : : : : : : : 1540 1540 1540 1540 1540 1540 1540 1540 1540 1540 1540 1540 1540 1540 1540 : : : : : : : : : : : : : : : * 1560 * 1580 * 1600 * 1620 * 1640 * ACAAGGGGTACGAGGTAGTCGCGAATCTATTCCAGGTGCCCCAGAATCCCGTAGTCGACGGGATTCTTGCTTCACCTCGGGTACTCCGCGGTGCACACAACCTCGACTGC .G A .G .G CG A .A .G C A .A .G G T T .G T .T G T C .G A C A G T T T .C .G A C G T T C .G A T G T .T G A G T .T .C .G A G T .T .C .G A A .G T C .G A G T .T .C .G A : : : : : : : : : : : : : : : 1650 1650 1650 1650 1650 1650 1650 1650 1650 1650 1650 1650 1650 1650 1650 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 1660 * 1680 * 1700 * 1720 * 1740 * 1760 GTGTTAAGAGAGGGTGCCACGCTATTCCCTGTGGTTATTACGACAGTGGAAGACGCCATGACACCCAAAGCATTGAACAGCAAAATGTTTGCTGTCATTGAAGGCGTGCG C C C .C.A C C .A .C C .C.G C C T C .G C C T C .G C C T C .G C C T C .G C C T C .G C C T C .G C C T C .G C C T C : : : : : : : : : : : : : : : 1760 1760 1760 1760 1760 1760 1760 1760 1760 1760 1760 1760 1760 1760 1760 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 1780 * 1800 * 1820 * 1840 * 1860 * AGAAGACCTCCAACCTCCTTCTCAAAGAGGATCCTTCATACGAACTCTCTCTGGACACAGAGTCTATGGATATGCTCCAGGTGGGGTACTTCCACTGGAGACTGGGAGAG A A A A A A G A C A A G C A A A G C A A C C T A G A C T A A TT A C G T A A T A C T A T A A C T A A C T A T A C T A T A C T A A : : : : : : : : : : : : : : : 1870 1870 1870 1870 1870 1870 1870 1870 1870 1870 1870 1870 1870 1870 1870 Kết thúc gen VP2 ▼ Kết thúc gen VPx ▼ Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 191 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 1880 * 1900 * 1920 * 1940 * 1960 * 1980 ACTACACCGTTGTCCCAATAGATGATGTCTGGGACGACAGCATTATGCTGTCCAAAGATCCCATACCTCCCATTGTGGGAAACAGTGGAAATCTAGCCATAGCTTACATG T T T C T C T .T G C T .T C T G .T .C T C C C .T G .C C C C .T G C C T C C T G .C T C CC T G .C T C C Y T T G .C T G C C T G G C T C T G .T .C C C A : : : : : : : : : : : : : : : 1980 1980 1980 1980 1980 1980 1980 1980 1980 1980 1980 1980 1980 1980 1980 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 2000 * 2020 * 2040 * 2060 * 2080 * GATGTGTTTCGACCCAAAGTCCCAATCCATGTGGCTATGACGGGAGCCCTCAATGCTTGTGGCGAGATTGAGAAAGTAAGCTTTAGAAGCACCAAGCTCGCCACTGCACA .T .C C .C A C T C C A T .C C A C C .C C.A .C G .C C .C C.A .T G .A .C C C .C C.A .C G .C C .C C.A .C G .T V A T C G C C.A .C G .A .C A C .C C.A .C G .C C .C C.A .C G .C C .C C.A .C G : : : : : : : : : : : : : : : 2090 2090 2090 2090 2090 2090 2090 2090 2090 2090 2090 2090 2090 2090 2090 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 2100 * 2120 * 2140 * 2160 * 2180 * 2200 CCGACTTGGCCTTAAGTTGGCTGGTCCCGGAGCATTCGATGTAAACACCGGGCCCAACTGGGCAACGTTCATCAAACGTTTCCCTCACAATCCACGCGACTGGGACAGGC G .G C .T C C C G C C C .T T C G G T G T T C .T T C G .T G T T C .T T C G .T G T C T T T C G .T G T T C C .T T C G .T G T T C .T T C G .T G T T C .T T C G .T G T T C .T C T C G .T G .T G : : : : : : : : : : : : : : : 2200 2200 2200 2200 2200 2200 2200 2200 2200 2200 2200 2200 2200 2200 2200 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 2220 * 2240 * 2260 * 2280 * 2300 * TCCCCTACCTCAACCTACCATACCTTCCACCCAATGCAGGGCGCCAGTACCACCTTGCCATGGCTGCATCAGAGTTCAAAGAGACCCCCGAACTCGAGAGTGCCGTCAGA A A A T .A C C G T C G T .A .T C T .A .T C T T C A .G G C T C TT A .G G C C A .G T T T A .G G C T C T T .A .G G C T C T T .A .G G C T G C T T .C A .G G C T C T T .A .G G T C T A .C T .A .G G C T : : : : : : : : : : : : : : : 2310 2310 2310 2310 2310 2310 2310 2310 2310 2310 2310 2310 2310 2310 2310 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 2320 * 2340 * 2360 * 2380 * 2400 * 2420 GCAATGGAAGCAGCAGCCAACGTGGACCCACTATTCCAATCTGCACTCAGTGTGTTCATGTGGCTGGAAGGGAATGGGATTGTGACTGACATGGCCAACTTCGCACTCAG A A A C GT A G A C G A .C C A .C T T G G C A .C T .T C G C G C A T G.T T C G G C A T C G G C A T .T C G C G C A T C G G C A T C G T G .AA C G G C A T : : : : : : : : : : : : : : : 2420 2420 2420 2420 2420 2420 2420 2420 2420 2420 2420 2420 2420 2420 2420 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 2440 * 2460 * 2480 * 2500 * 2520 * CGACCCGAACGCCCATCGGGTGCGAAATTTTCTTGCAAACGCACCACAAGCAGGCAGCAAGTCGCAAAGGGCCAAGTACGGGACAGCAGGCTACGGAGTGGAGGCTCGGG A .A .A .A .C T T A C .A C .C .A G C .T A A C C .C.A A C .A T C C A G T A C C G A C .A C C A C .A C C A C .T .A C C A C .A C C A C .A C C A C : : : : : : : : : : : : : : : 2530 2530 2530 2530 2530 2530 2530 2530 2530 2530 2530 2530 2530 2530 2530 Kết thúc gen VP4 ▼ Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 192 193 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 2540 * 2560 * 2580 * 2600 * 2620 * 2640 GCCCCACACCAGAGGAAGCACAGAGGGAAAAAGACACACGGATCTCAAAGAAGATGGAGACCATGGGCATCTACTTTGCAACACCAGAATGGGTAGCACTCAATGGGCAC .A C .T .T G G .T G T G T T .T T .C .T A A .T T G.T .T G .T .T A .T : : : : : : : : : : : : : : : 2640 2640 2640 2640 2640 2640 2640 2640 2640 2640 2640 2640 2640 2640 2640 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 2660 * 2680 * 2700 * 2720 * 2740 * CGAGGGCCAAGCCCCGGCCAGCTAAAGTACTGGCAGAACACACGAGAAATACCGGACCCAAACGAGGACTATCTAGACTACGTGCATGCAGAGAAGAGCCGGTTGGCATC G.C G T T T C G T T C G T T C G G T T C G T T C G T T C G G T T C G T T C : : : : : : : : : : : : : : : 2750 2750 2750 2750 2750 2750 2750 2750 2750 2750 2750 2750 2750 2750 2750 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 2760 * 2780 * 2800 * 2820 * 2840 * 2860 AGAAGAACAAATCCAAAGGGCAGCTACGTCGATCTACGGGGCTCCAGGACAGGCAGAGCCACCCCAAGCTTTCATAGACGAAGTTGCCAAAGTCTATGAAATCGACCATG T A T A T G A T A TT A A A T A C A T G C C T .A T .T G C C A T G .G C C T .A T G G C T G C A T G C C A T G C C A T C C A T G C C T .A : : : : : : : : : : : : : : : 2860 2860 2860 2860 2860 2860 2860 2860 2860 2860 2860 2860 2860 2860 2860 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 2880 * 2900 * 2920 * 2940 * 2960 * GACGTGGCCCAAACCAAGAACAGATGAAAGATCTGCTCTTGACTGCGATGGAGATGAAGCATCGCAATCCCAGGCGGGCTCTACCAAAGCCCAAGCCAAAACCCAATGCT G .C .G C G C C .C .G C C T .G C G .T C .G C T G C T .G C C T .G C .C C T .G C C T .G C C T .G C C T : : : : : : : : : : : : : : : 2970 2970 2970 2970 2970 2970 2970 2970 2970 2970 2970 2970 2970 2970 2970 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 2980 * 3000 * 3020 * CCAACACAGAGACCCCCTGGTCGGCTGGGCCGCTGGATCAGAACCGTCTCTGATGAGGACCTTGAGTGA G T G G .G G T G T G T GG.T GG.T GG.T T GG.T GG.T GG.T GG.T GG.T : : : : : : : : : : : : : : : 3039 3039 3039 3039 3039 3039 3039 3039 3039 3039 3039 3039 3039 3039 3039 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 193 194 b Amino acid 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 20 * 40 * 60 * 80 * 100 * MTNLQDQTQQIVPFIRSLLMPTTGPASIPGDTLEKHTLRSETSTYNLTVGDTGSGLIVFFPGFPGSIVGAHYTLQSNGNYKFDQMLLTAQNLPASYNYCRLVSRSLTVRS .D .D .D .D .D .L D P D S .D P D .D .D .D .D .D : : : : : : : : : : : : : : : 110 110 110 110 110 110 110 110 110 110 110 110 110 110 110 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 120 * 140 * 160 * 180 * 200 * 220 STLPGGVYALNGTINAVTFQGSLSELTDVSYNGLMSATANINDKIGNVLVGEGVTVLSLPTSYDLGYVRLGDPIPAIGLDPKMVATCDSSDRPRVYTITAADDYQFSSQY I L .E .N R E .N : : : : : : : : : : : : : : : 220 220 220 220 220 220 220 220 220 220 220 220 220 220 220 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 240 * 260 * 280 * 300 * 320 * QPGGVTITLFSANIDAITSLSVGGELVFQTSVHGLVLGATIYLIGFDGTAVITRAVAANSGLTTGTDNLLPFNLVIPTNEITQPITSIKLEIVTSKSGGQAGDQMSWSAR T .N .M S K N Q .AT .N .M T K QS S N A M E S Q .F T DN A M V .S .I Q .DN A M .S Q T DN A M I S A I Q I DN A M I S .N S A I Q I DN A M I S S A I Q I DN A M I S S A I Q I .N A M I S S A I Q I DN A M I S S A I Q I DN A M I S K S A I I E DN .M I S S : : : : : : : : : : : : : : : 330 330 330 330 330 330 330 330 330 330 330 330 330 330 330 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 340 * 360 * 380 * 400 * 420 * 440 GSLAVTIHGGNYPGALRPVTLVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDPGAMNYTKLILSERDRLGIKTVWPTREYTDFREYFMEVADLNSPLKIAG S I .I : : : : : : : : : : : : : : : 440 440 440 440 440 440 440 440 440 440 440 440 440 440 440 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : VP2 VPx 460 * 480 * 500 VPx * 540 * ▼ ▼VP4 520 AFGFKDIIRAIRRIAVPVVSTLFPPAAPLAHAIGEGVDYLLGDEAQAASGTARAASGKARAASGRIRQLTRAADKGYEVVANLFQVPQNPVVDGILASPRVLRGAHNLDC L G L G L G L GI L G L H G L L GI L L GI L L GI L .T .L GI L S L GI L L GI L L .T GI L L GI : : : : : : : : : : : : : : : 550 550 550 550 550 550 550 550 550 550 550 550 550 550 550 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 560 * 580 * 600 * 620 * 640 * 660 VLREGATLFPVVITTVEDAMTPKALNSKMFAVIEGVREDLQPPSQRGSFIRTLSGHRVYGYAPGGVLPLETGRDYTVVPIDDVWDDSIMLSKDPIPPIVGNSGNLAIAYM .D .D .D .D I D K .D .D .D .F .D .D .T .D - D .D .V .D .R : : : : : : : : : : : : : : : 660 660 660 660 660 660 660 660 660 660 660 659 660 660 660 Trường ðại học Nông nghiệp Hà Nội – Luận án tiến sĩ khoa học nông nghiệp ……… 194 194 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 680 * 700 * 720 * 740 * VP4▼VP3 * DVFRPKVPIHVAMTGALNACGEIEKVSFRSTKLATAHRLGLKLAGPGAFDVNTGPNWATFIKRFPHNPRDWDRLPYLNLPYLPPNAGRQYHLAMAASEFKETPELESAVR R .I .F .Y N A.S D Y N K .S S D K .Y N S F D Y N S D - .Y N S D .G .Y N S D Y N S D Y N S R D : : : : : : : : : : : : : : : 770 770 770 770 770 770 770 770 770 770 770 768 770 770 770 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 780 * 800 * 820 * 840 * 860 * 880 AMEAAANVDPLFQSALSVFMWLEGNGIVTDMANFALSDPNAHRVRNFLANAPQAGSKSQRAKYGTAGYGVEARGPTPEEAQREKDTRISKKMETMGIYFATPEWVALNGH .E M E M E M S E M E M A .E M E F .M E D F .M .S E M E M E M E M V A H E M .V E M : : : : : : : : : : : : : : : 880 880 880 880 880 880 880 880 880 880 880 878 880 880 880 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : * 900 * 920 * 940 * 960 * 980 * RGPSPGQLKYWQNTREIPDPNEDYLDYVHAEKSRLASEEQIQRAATSIYGAPGQAEPPQAFIDEVAKVYEIDHGRGPNQEQMKDLLLTAMEMKHRNPRRALPKPKPKPNA L N .L N .L N .L N P R .A LK N L P .LK N P .L N P V L N P .L R .N H P V L N P V L N P P V L N P V L N P V L N P V : : : : : : : : : : : : : : : 990 990 990 990 990 990 990 990 990 990 990 988 990 990 990 52-70 Cu1 D78 CS-2-35 GLS STC IM BDG23 GHUT-12 G202 HK46 SH-92 OKYM Harbin-1 NB : : : : : : : : : : : : : : : 1000 * PTQRPPGRLGRWIRTVSDEDLE A A A A A A A A .- : : : : : : : : : : : : : : : 1012 1012 1012 1012 1012 1012 1012 1012 1012 1012 1012 1010 1012 1012 1012 ... mối quan hệ nguồn gốc phả hệ chủng Gumboro Việt Nam giới d a gen phân đoạn A Phân tích so sánh thành phần gen, mối quan hệ nguồn gốc phả hệ chủng Gumboro Việt Nam giới d a tồn phân đoạn A 2.2 VẬT... IBDV Việt Nam giới sở gen VP5 thành phần nucleotide amino acid Mối quan hệ nguồn gốc phả hệ chủng IBDV Việt Nam giới sở gen VP4 thành phần nucleotide amino acid Mối quan hệ nguồn gốc phả hệ chủng. .. chủng IBDV Việt Nam giới sở gen VP3 thành phần nucleotide amino acid Mối quan hệ phả hệ chủng IBDV Việt Nam chủng giới sở phân tích tồn phân đoạn A (VP2-4-3) thành phần nucleotide amino acid………
- Xem thêm -

Xem thêm: Giải mã phân đoạn a hệ gen các chủng virus GUMBORO phân lập ở việt nam nhằm cung cấp nguồn gen cho nghiên cứu vacxin thế hệ mới , Giải mã phân đoạn a hệ gen các chủng virus GUMBORO phân lập ở việt nam nhằm cung cấp nguồn gen cho nghiên cứu vacxin thế hệ mới

Gợi ý tài liệu liên quan cho bạn