TỔNG HỢP VÀ TẠO DÕNG PHÂN TỬ GEN INTERFERON ALPHA 2A

44 70 0
  • Loading ...
Loading...
1/44 trang

Thông tin tài liệu

Ngày đăng: 29/04/2017, 08:57

Header Page of 134 BỘ GIÁO DỤC VÀ ĐÀO TẠO TRƢỜNG ĐẠI HỌC NÔNG LÂM TP.HCM BỘ MÔN CÔNG NGHỆ SINH HỌC ***000*** HOÀNG ĐỨC CHIẾN TỔNG HỢP VÀ TẠO DÕNG PHÂN TỬ GEN INTERFERON ALPHA 2A Luận văn kỹ sƣ Chuyên ngành: Công nghệ sinh học Thành phố Hồ Chí Minh Tháng 8/2006 Footer Page of 134 Header Page of 134 BỘ GIÁO DỤC VÀ ĐÀO TẠO TRƢỜNG ĐẠI HỌC NÔNG LÂM TP.HCM BỘ MÔN CÔNG NGHỆ SINH HỌC ***000*** TỔNG HỢP VÀ TẠO DÕNG PHÂN TỬ GEN INTERFERON ALPHA 2A Luận văn kỹ sƣ Chuyên ngành: Công nghệ sinh học Giáo viên hƣớng dẫn: Sinh viên thực hiện: ThS TRẦN QUỲNH HOA HOÀNG ĐỨC CHIẾN Khóa: 2002 – 2006 Thành phố Hồ Chí Minh Tháng 8/2006 Footer Page of 134 Header Page of 134 MINISTRY OF EDUCATION AND TRAINING NONG LAM UNIVERSITY, HCMC DEPARTMENT OF BIOTECHNOLOGY ***000*** SYNTHESIZE AND CLONE MOLECULE GEN INTERFERON ALPHA 2A Graduation thesis Major: Biotechnology Professor: Student: Ma TRAN QUYNH HOA HOANG DUC CHIEN Term: 2002 – 2006 HCMC 8/2006 Footer Page of 134 iii Header Page of 134 LỜI CẢM ƠN Tôi xin chân thành cảm ơn:  Ban Giám Hiệu trƣờng Đại Học Nông Lâm thành phố Hồ Chí Minh  Ban chủ nhiệm Bộ môn Công Nghệ Sinh Học, tất quý thầy cô truyền đạt kiến thức cho trình học trƣờng  Ban giám đốc công ty NTL Biotech tạo điều kiện thuận lợi để hoàn thành khóa luận  Thạc sĩ Trần Quỳnh Hoa hết lòng hƣớng dẫn truyền đạt kinh nghiệm quý báu cho suốt trình thực tập tốt nghiệp  Các anh chị phòng thí nghiệm công ty NTL Biotech tận tình giúp đỡ, tạo điều kiện thuận lợi cho trình thực tập tốt nghiệp  Các bạn bè thân yêu lớp CNSH K28 giúp đỡ chia sẻ vui buồn thời gian học nhƣ hết lòng hỗ trợ thời gian thực tập tốt nghiệp Footer Page of 134 iv Header Page of 134 TÓM TẮT KHÓA LUẬN HOÀNG ĐỨC CHIẾN, Đại Học Nông Lâm TP Hồ Chí Minh, tháng 8/2006, “TỔNG HỢP VÀ TẠO DÒNG PHÂN TỬ GEN INTERFERON ALPHA 2A ” Hƣớng dẫn khoa học: ThS Trần Quỳnh Hoa Đề tài đƣợc tiến hành từ ngày 06-02-2006 đến ngày 31-07-2005 phòng thí nghiệm sinh học phân tử công ty NTL Biotech Ở nƣớc ta việc sử dụng interferon chữa trị bệnh nhƣ ung thƣ, bệnh virus gây phổ biến Nhƣng interferon chủ yếu đƣợc sản xuất nƣớc với giá cao Do thực tổng hợp tạo dòng gen interferon alpha 2a Kết đạt đƣợc nhƣ sau: Tổng hợp đƣợc gen interferon alpha 2a Biến nạp đƣợc gen vào vi khuẩn E coli Top10 F’ Kiểm tra đƣợc đoạn gen chèn kỹ thuật PCR, enzyme cắt điện di Đƣa mẫu giải trình tự xác định trình tự đoạn gen Footer Page of 134 v Header Page of 134 MỤC LỤC CHƢƠNG TRANG Lời cảm ơn iii Tóm tắt khóa luận iv Mục lục v Danh sách chữ viết tắt viii Danh sách hình ix PHẦN I GIỚI THIỆU 1.1 Đặt vấn đề 1.2 Mục đích - yêu cầu 1.2.1 Mục đích 1.2.2 Yêu cầu PHẦN II TỔNG QUAN TÀI LIỆU 2.1 Sơ lƣợc interferon 2.1.1 Đặc điểm chung interferon 2.1.2 Đặc điểm interferon alpha 2a 2.1.3 Tình hình nghiên cứu 2.2 Kỹ thuật PCR (polymerase chain reaction) 2.2.1 Giới thiệu phản ứng PCR 2.2.2 Một số yếu tố tham gia vào phản ứng PCR 2.2.2.1 Enzyme DNA polymerase 2.2.2.2 Các nucleotide tự (dNTPs) 2.2.2.3 Primer nhiệt độ lai 2.2.2.4 DNA khuôn 2.2.2.5 Dung dịch đệm 2.2.2.6 Số chu kỳ phản ứng 2.2.2.7 Nhiệt độ pH 2.2.3 Tổng hợp gen 2.2.4 Ứng dụng PCR Footer Page of 134 vi Header Page of 134 2.3 Kỹ thuật điện di DNA 2.4 Hiện tƣợng biến nạp vi khuẩn 2.4.1 Hiện tƣợng biến nạp 2.4.2 Vector – công cụ biến nạp 2.4.2.1 Plasmid 2.4.2.2 Phage 2.4.3 Biến nạp nhân tạo vi khuẩn 10 2.4.3.1 Chuẩn bị tế bào khả nạp 10 2.4.3.2 Chọn lọc tế bào vi khuẩn đƣợc biến nạp 10 2.4.4 Vai trò ứng dụng 13 2.5 Tách chiết DNA plasmid 13 2.6 Một số enzyme sử dụng biến nạp 13 2.6.1 Enzyme cắt giới hạn 13 2.6.2 Enzyme nối 15 2.7 Nguyên tắc đọc trình tự 15 2.7.1 Phƣơng pháp đọc trình tự Sanger 15 2.7.2 Giải mã trình tự hệ thống tự động 15 PHẦN III VẬT LIỆU VÀ PHƢƠNG PHÁP 16 3.1 Thời gian địa điểm thực đề tài 16 3.2 Vật liệu 16 3.2.1 Vật liệu làm thí nghiệm 16 3.2.1.1 Sáu đoạn oligonucleotide hai primer 16 3.2.1.2 Vi khuẩn E coli Top10 F’ 17 3.2.1.3 Plasmid pGEM-T 17 3.2.2 Dụng cụ thí nghiệm 17 3.2.3 Thiết bị máy móc 18 3.2.4 Hóa chất sử dụng 18 3.3 Phƣơng pháp nghiên cứu 19 3.3.1 Tổng hợp gen IFN-α2a PCR chạy điện di kiểm tra 19 3.3.1.1 Tổng hợp đoạn gen 19 3.3.1.2 Chạy điện di kiểm tra 20 3.3.2 Tinh DNA từ gel thực phản ứng A-Tailing cho đoạn DNA 20 Footer Page of 134 vii Header Page of 134 3.3.3 Thực phản ứng nối DNA đƣợc A-Tailing vào plasmid pGEM-T 21 3.3.4 Chuẩn bị tế bào khả nạp thực phản ứng biến nạp 22 3.3.5 Chọn lọc khuẩn lạc mong muốn 23 3.3.6 Quy trình tách plasmid 23 3.3.7 Chạy PCR kiểm tra 23 3.3.8 Thực phản ứng cắt plasmid enzyme cắt giới hạn 24 PHẦN IV KẾT QUẢ VÀ THẢO LUẬN 25 4.1 Phản ứng tổng hợp IFN-α2a 25 4.2 Tạo dòng phân tử IFN-α2a 26 4.2.1 Kết biến nạp 26 4.2.2 Tách plasmid 26 4.3 Kết kiểm tra 27 4.3.1 Kiểm tra PCR 27 4.3.2 Cắt enzyme cắt giới hạn 28 4.4 Kết giải trình tự 28 Phần V KẾT LUẬN VÀ ĐỀ NGHỊ 30 5.1 Kết luận 30 5.2 Đề nghị 30 TÀI LIỆU THAM KHẢO 31 PHỤ LỤC 33 Footer Page of 134 viii Header Page of 134 DANH SÁCH CÁC CHỮ VIẾT TẮT bp base pair CAP catabolyte gen activator protein CRP cAMP recepter protein DNA deoxyribonucleic acid dNTP 3’-deoxynucleotide-5’-triphosphate dATP 3’-deoxyadenine-5’-triphosphate dCTP 3’-deoxycytosine-5’-triphosphate dGTP 3’-deoxyguanine-5’-triphosphate dTTP 3’-deoxythyamine-5’-triphosphate ddNTP dideoxynucleotide EDTA ethylene diamin tetracetic acid E coli Escherichia coli IFN interferon IFN-α2a interferon alpha 2a IPTG isopropyl-β-D-thiogalactoside kb kilobase ng nanogram NST nhiễm sắc thể MCS multiple cloning site mRNA messenger ribonucleic acid µg microgram OD optical density PCR polymerase chain reaction RNA ribonucleic acid SDS sodium dodecyl sulfat TAE tricacetic ethylene diamine tetra acetate Taq thermus aquaticus TE tris ethylene diamine tetra acetate X-gal 5-bromo-4 chloro-3 indolyl-β-D galactopyranoside Footer Page of 134 ix Header Page 10 of 134 DANH SÁCH CÁC HÌNH Trang Hình 2.1: Cấu trúc 3D interferon Hình 2.2: Các chu kỳ phản ứng PCR Hình 2.3: Mô hình plasmid sử dụng cho cloning Hình 2.4: Cấu trúc phage T4 Hình 2.5: Cấu trúc operon lac 11 Hình 3.1: Vector pGEM-T 17 Hình 3.2: Mô hình nối gen chèn vào vector T 22 Hình 4.1: Kết tổng hợp gen 25 Hình 4.2: Kết cấy vi khuẩn môi trƣờng chọn lọc 26 Hình 4.3: Kết điện di plasmid gel agarose 1% 27 Hình 4.4: Kết PCR kiểm tra 27 Hình 4.5: Kiểm tra enzyme cắt 28 Hình 4.6: Trình tự đoạn gen IFN- 2a tổng hợp đƣợc 28 Hình 4.7: Kết so sánh trình tự acid amin 29 Footer Page 10 of 134 x Header Page 30 of 134 20 94oC 30 giây 50oC 30 giây 72oC 40 giây 15 chu kỳ Chuẩn bị phản ứng 48 μl gồm thành phần sau: Mỗi oligonucleotide (15 μM) μl Platinum® Pfx DNA Polymerase (5 U/µl) µl dNTPs (10 mM) μl 10X PCR buffer μl Nƣớc khử ion 31 μl - Bƣớc thực phản ứng PCR: sau thực xong việc nối oligonucleotide, μl primer Forward Reverse đƣợc thêm vào phản ứng Sau phản ứng PCR đƣợc thực theo chƣơng trình sau: 94oC phút 94oC 30 giây 50oC 30 giây 72oC 35 giây 72oC phút 30 chu kỳ 3.3.1.2 Chạy điện di kiểm tra Chuẩn bị đổ gel, gắn lƣợc vào khuôn; cân 0,5 g agarose cho vào 50 ml 1X TAE sau đun nóng lò vi sóng khoảng phút Cho thêm khoảng μl ethiumbromide lắc Để nguội khoảng 50 – 60oC, đổ gel vào khuôn Khi gel nguội gỡ lƣợc khỏi gel, sau đặt gel vào bồn điện di có sẵn 1X TAE cách nhẹ nhàng Chuẩn bị miếng parafilm hút μl loading buffer cho mẫu điện di, hút mẫu cần điện di trộn với loading buffer, hút toàn dung dịch vừa trộn vào giếng Đậy nắp bồn điện di, cắm điện cực, chạy với hiệu địên 100 V, thời gian 30 phút Sau điện di xong lấy gel đọc kết dƣới tia UV 3.3.2 Tinh DNA từ gel thực phản ứng A-Tailing cho đoạn DNA Quy trình tinh DNA từ gel Nhằm phân tách thu nhận đoạn gene IFN- 2a mong muốn từ gel agarose sau điện di Phƣơng pháp sử dụng kit QIAquick Gel Extraction Qiagen Quy trình thực nhƣ sau: Bƣớc 1: Gel sau chạy điện di, đƣợc đƣa lên hệ thống UV Footer Page 30 of 134 Header Page 31 of 134 21 Bƣớc 2: Dùng dao cắt phần gel chứa băng DNA cần đƣợc tinh cho vào eppendoft 1,5 ml Bƣớc 3: Thêm buffer QG vào eppendorf chứa gel với tỷ lệ 100 mg gel ≈ 300 µl buffer QG Bƣớc 4: Đậy nắp lại ủ 50oC khoảng 10 – 15 phút agarose tan hoàn toàn Bƣớc 5: Sau gel tan, kiểm tra màu hỗn hợp gel Nếu có màu cam tím, thêm 10 μl M sodium acetate pH 5,0 trộn để hỗn hợp chuyển sang màu vàng Bƣớc 6: Thêm isopropanol vào eppendorf với tỷ lệ 100 mg gel ≈ 100 μl isopropanol Bƣớc 7: Chuẩn bị cột QIAquick, đặt vào eppendorf tƣơng ứng với số mẫu cần tinh Bƣớc 8: Hút mẫu cho vào cột chuẩn bị trên, ly tâm 13000 vòng/phút phút, loại bỏ phần dịch Bƣớc 9: Thêm 0,75 ml buffer PE, ly tâm 13000 vòng/ phút phút Bƣớc 10: Loại bỏ phần dịch dƣới, ly tâm 13000 vòng/phút phút Bƣớc 11: Lấy cột để vào eppendorf 1,5 ml Bƣớc 12: Thêm 50 μl buffer EB (10 mM Tris-Cl, pH 8,5) vào cột Ly tâm 13000 vòng/phút phút Thu dịch chứa DNA Thực phản ứng A-Tailing Phản ứng nhằm gắn dATP vào hai đầu 3’ đoạn gen IFN-α2a Phản ứng 10 μl bao gồm: Sản phẩm PCR μl 10X buffer PCR μl dATP (10 mM) 0,5 μl Taq DNA polymerase 0,5 μl H2 O μl Trộn nhẹ pipet, ủ 72oC khoảng 15 – 30 phút 3.3.3 Thực phản ứng nối DNA đƣợc A-Tailing vào plasmid pGEM-T Nguyên tắc: dATP đầu 3’ gen IFN-α2a bắt cặp bổ sung với dTTP đầu 3’ vector pGEM-T nhờ enzyme T4 ligase Footer Page 31 of 134 Header Page 32 of 134 22 Hình 3.2: Mô hình nối gen chèn vào vector pGEM-T Thực phản ứng nối 10 µl với thành phần nhƣ sau: 2X buffer µl IFN-α2a gắn A µl Vector pGEM-T µl T4 ligase (1 U/µl ) µl Trộn phản ứng pipet ủ nhiệt độ phòng 3.3.4 Chuẩn bị tế bào khả nạp thực phản ứng biến nạp Chuẩn bị tế bào khả nạp Bƣớc 1: Trải giống lên đĩa môi trƣờng LB có chứa 10 μg/ml tetracyclin, nuôi qua đêm 37oC Bƣớc 2: Chọn khuẩn lạc đƣờng kính – mm vào ống nghiệm chứa – ml môi trƣờng LB có tetracyclin, nuôi cấy tủ lắc 37oC qua đêm Bƣớc 3: Hút dịch nuôi cấy qua đêm vào lọ thủy tinh chứa 100 ml môi trƣờng LB có tetracyclin Khi OD đạt khoảng 0,7 chuyển lọ chứa môi trƣờng nuôi cấy sang thùng đá giữ lạnh 10 phút Bƣớc 4: Ly tâm dịch tế bào 5000 vòng/phút 10 phút 4oC Bƣớc 5: Sau ly tâm đổ bỏ phần dịch nổi, giữ lại phần tủa Bƣớc 6: Thêm 20 ml glycerol 10 %, vortex nhẹ nhàng sau ly tâm 5000 vòng 10 phút 4oC, đổ bỏ phần dịch Lặp lại bƣớc lần Bƣớc 7: Thêm khoảng 300 μl glycerol 10 %, lắc nhẹ cho tế bào tan Hút khoảng 40 μl cho vào eppendorf 1,5 ml, trữ -70oC Thực phản ứng biến nạp Sử dụng phƣơng pháp chuyển gen xung điện Sử dụng điện trƣờng mạnh thời gian ngắn làm tạm thời tính ổn định màng tế bào tạo thành lỗ màng cho DNA plasmid qua Quy trình thực nhƣ sau: Footer Page 32 of 134 Header Page 33 of 134 23 Bƣớc 1: Lấy ống eppendorf chứa 40 μl tế bào khả nạp từ –70oC đặt đá cho tế bào tan ra, thêm μl DNA plasmid, trộn nhẹ nhàng pipet Bƣớc 2: Cho hỗn hợp tế bào vào cuvette 0,2 cm, để đá khoảng phút Bƣớc 3: Để cuvette vào máy cho dòng điện 2,5 kV qua Bƣớc 4: Thêm 200 μl môi trƣờng LB lỏng vào cuvette, ủ 37oC cho Bƣớc 5: Hút lần lƣợt khoảng 40 μl, 60 μl 100 μl cấy sang đĩa môi trƣờng LB agar chứa tetracyclin ampicillin Nuôi 37oC qua đêm 3.3.5 Chọn lọc khuẩn lạc mong muốn Nguyên tắc chọn lọc khuẩn lạc mong muốn dựa vào kháng sinh ampicillin phản ứng tạo màu X-Gal môi trƣờng có IPTG Sau ủ qua đêm, đĩa xuất khuẩn lạc màu trắng màu xanh Những khuẩn lạc màu trắng thƣờng chứa plasmid mang gene ngoại lai Để kiểm tra diện đoạn gene vector tạo dòng tiến hành chọn khoảng 10 khuẩn lạc cho vào 10 ống nghiệm chứa ml môi trƣờng LB lỏng có tetracyclin (10 μg/ml) ampicillin (100 μg/ml) Nuôi cấy qua đêm tủ lắc 37oC 3.3.6 Quy trình tách plasmid Bƣớc 1: Hút 1,5 ml dịch vi khuẩn nuôi cấy qua đêm 37oC vào eppendorf, ly tâm 13000 vòng/phút phút nhiệt độ phòng Bƣớc 2: Loại bỏ phần dịch nổi, thêm 100 μl TE, vortex tế bào tan hết Bƣớc 3: Thêm 200 μl dung dịch II, đảo nhẹ Bƣớc 4: Thêm 150 μl dung dịch III, đảo nhẹ, để vào đá khoảng 10 phút Bƣớc 5: Ly tâm 13000 vòng/phút khoảng phút Hút phần dịch chuyển qua eppendorf có 900 μl ethanol 100 % Giữ đá khoảng 10 phút Bƣớc 6: Ly tâm 13000 vòng/phút phút, loại bỏ phần dịch nổi, giữ tủa lại Bƣớc 7: Rửa tủa 500 μl ethanol 70 %, ly tâm 13000 vòng/phút phút, loại bỏ phần dịch Lập lại hai lần bƣớc Bƣớc 8: Để khô mẫu, thêm vào eppendorf 40 μl TE Sau tách plasmid, thực điện di gel agarose theo quy trình 3.3.1.2 để kiểm tra 3.3.7 Chạy PCR kiểm tra Sau tách plasmid theo quy trình 3.3.6 kiểm tra thực phản ứng PCR để nhân đoạn gen chèn Phản ứng 25 μl với thành phần sau: Footer Page 33 of 134 Header Page 34 of 134 24 - 10X PCR buffer 2,5 μl - dNTPs 10 mM μl - primer Forward μM μl - primer Reverse μM μl - Tag DNA polymerase (5 U/ μl) 0,25 μl - Plasmid μl - H2 O 16,25 μl Thực phản ứng theo chƣơng trình chạy PCR tổng hợp gen 3.3.1.1 Sau chạy PCR thực chạy điện di nhƣ quy trình 3.3.1.2 để kiểm tra đoạn gen chèn 3.3.8 Thực phản ứng cắt plasmid enzyme giới hạn Sau kiểm tra phƣơng pháp PCR, thực phản ứng cắt plasmid enzyme giới hạn để khẳng định diện đoạn gen Enzyme giới hạn đƣợc dùng XhoI XbaI Trộn phản ứng 20 μl với thành phần sau: Plasmid μl 10X buffer μl BSA 100X 0,2 μl Xhol I (20 U/ μl) 0,3 μl Xbal I (20 U/μl) 0,3 μl H2 O 10,2 μl Trộn phản ứng nhẹ nhàng, sau ủ 37oC Đem điện di xem kết Footer Page 34 of 134 Header Page 35 of 134 25 PHẦN IV KẾT QUẢ VÀ THẢO LUẬN 4.1 Phản ứng tổng hợp IFN-α2a Nhƣ biết IFN-α2a đoạn gen nằm NST số ngƣời Để có đƣợc đoạn gen IFN-α2a ngƣời ta phân lập đoạn gen từ genome tổng hợp nhân tạo đoạn gen Dựa vào điều kiện phòng thí nghiệm tiến hành với phƣơng pháp tổng hợp nhân tạo Những đoạn oligonucleotide đƣợc thiết kế cho phù hợp để E coli nhận biết trình dịch mã acid amin Bên cạnh thiết kế hai primer có vị trí nhận biết enzyme cắt giới hạn lần lƣợt primer Xho I Xba I để phục vụ cho trình kiểm tra diện đoạn gen dễ dàng trình chuyển gen vào vector biểu sau Sau tiến hành tổng hợp gen IFN-α2a từ oligonucleotide với primer Forward Reverse thực điện di gel agarose % có kết sau: 500 bp Hình 4.1: Kết tổng hợp gen 1;2: Đoạn gen tổng hợp 3: Leader kb plus Kết hình 4.1 cho thấy sản phẩm PCR có kích thƣớc khoảng 500 bp, phù hợp với kích thƣớc đoạn gen mong muốn Để có đƣợc lƣợng DNA mong muốn sử dụng cho tạo dòng thực biện pháp kiểm tra, tiến hành tinh đoạn DNA từ gel Ở khóa luận sử dụng kit QIAquick Gel Extraction (của hãng Qiagen) Sau tinh thực kiểm tra gel Footer Page 35 of 134 Header Page 36 of 134 26 4.2 Tạo dòng phân tử IFN-α2a 4.2.1 Kết biến nạp Sau DNA đƣợc tinh sạch, thực phản ứng A-Tailing để gắn dATP vào đầu 3’ sợi DNA Tiếp DNA đƣợc chèn vào vector pGEM-T nhờ enzyme T4 ligase Vector đƣợc gắn gen đƣợc chuyển vào vi khuẩn E coli Top10F’ nhờ phƣơng pháp biến nạp xung điện Sau biến nạp, để xác định đƣợc vi khuẩn mang vector có chứa đoạn gen chèn thực chọn lọc dựa phƣơng pháp α-complementation Ủ dịch biến nạp 37oC khoảng sau cấy đĩa môi trƣờng chọn lọc có ampicillin, tetracycline, X-Gal IPTG, tiếp tục ủ qua đêm 37oC Trên đĩa xuất khuẩn lạc màu xanh màu trắng Những khuẩn lạc màu trắng thƣờng chứa vector có đoạn gen chèn mong muốn, khuẩn lạc màu xanh chứa vector tái bắt vòng Hình 4.2: Kết cấy vi khuẩn biến nạp môi trƣờng chọn lọc chứa ampicillin (100 μg/ml), tetracyclin (10 μg/ml) X-Gal/IPTG 4.2.2 Tách plasmid Sau chọn lọc đƣợc vi khuẩn môi trƣờng chọn lọc, để kiểm tra xem vi khuẩn có vector chứa gen hay không đồng thời để có mẫu vector biến nạp đem đọc trình tự phải có đƣợc plasmid từ vi khuẩn mà nghi ngờ mang gen mong muốn Chúng chọn đĩa có nhiều khuẩn lạc rời, sau dùng đầu tip chấm khuẩn lạc lớn màu trắng cấy sang môi lỏng chọn lọc có ampicillin tetracyclin, nuôi cấy tới OD đạt khoảng 0,7 tiến hành tách plasmid Sau chạy điện di gel agarose % để kiểm tra: Footer Page 36 of 134 Header Page 37 of 134 27 DNA plasmid Hình 4.3: Kết điện di plasmid gel agarose % 1, 2, 3, 4: Sản phẩm DNA plasmid chiết tách 5: Leader kb plus Kết cho thấy tách plasmid thành công Những plasmid đƣợc kiểm tra enzyme cắt PCR để xác định diện đoạn gen IFN-α2a 4.3 Kết kiểm tra 4.3.1 Kiểm tra PCR Để kiểm tra đoạn gen chèn vector thực phản ứng PCR Chúng thực PCR kiểm tra với hai primer Forward Reverse: 500 bp Hình 4.4: Kết PCR kiểm tra 1: Leader kb plus 2, 3, 4, 5: Sản phẩm PCR Sản phẩm PCR có kích thƣớc khoảng 500 bp chứng tỏ có đoạn gen IFN-α2a chèn mong muốn Footer Page 37 of 134 Header Page 38 of 134 28 4.3.2 Cắt enzymee giới hạn Sau kiểm tra PCR có kết mong muốn, để khẳng định thêm phần xác diện đoạn gen chèn kiểm tra phản ứng cắt giới hạn với hai enzyme XhoI XbaI 2,9 kb 0,5 kb Hình 4.5 Kiểm tra enzyme cắt 1: Leader kb 2: Sản phẩm plasmid đƣợc cắt Kết cho thấy sau cắt plasmid xuất hai băng khoảng kích thƣớc mong muốn 4.4 Kết giải trình tự Sau qua phƣơng pháp kiểm tra điện di plasmid, PCR có kết mong muốn gửi mẫu để giải trình tự Cặp mồi đƣợc sử dụng để giải trình tự là: T7 promoter SP6, hai mồi có vị trí bắt cặp bổ sung trình tự DNA vector pGEM-T TGT GAT CTG CCT CAA ACC CAT AGC CTG GGC AGC CGT CGT ACC CTG ATG CTG CTG GCG CAG ATG CGT AAA ATC AGC CTG TTT AGC TGC CTG AAA GAT CGT CAT GAT TTT GGC TTT CCG CAG GAA GAA TTT GGC AAC CAG TTT CAG AAA GCG GAA ACC ATC CCG GTT CTG CAT GAA ATG ATC CAG CAG ATC TTT AAC CTG TTT AGC ACC AAA GAT AGC AGC GCG GCG TGG GAT GAA ACC CTG CTG GAT AAA TTT TAT ACC GAA CTG TAT CAG CAG CTG AAC GAT CTG GAA GCG TGC GTT ATC CAG GGC GTTGGC GTT ACC GAA ACC CCG CTG ATG AAA GAA GAT AGC ATC CTG GCG GTT CGT AAA TAT TTT CAG CGT ATC ACC CTG TAT CTG AAA GAA AAA AAA TAT AGC CCG TGC GCG TGG GAA GTT GTT CGT GCG GAA ATC ATG CGT AGC TTT AGC CTG AGC ACC AAC CTG CAG GAA AGC CTG CGT AGT AAG GAA TGA Hình 4.6: Trình tự đoạn gen IFN- 2a tổng hợp đƣợc Footer Page 38 of 134 Header Page 39 of 134 29 Kết giải trình tự đƣợc dịch mã sang trình tự acid amin nhờ công cụ dịch mã (translate tool) ExPASy Sau đƣợc so sánh với trình tự acid amin IFN-α2a ngân hàng gen NCBI 100.0% identity in 165 residues overlap; Score: 851.0; Gap frequency: 0.0% UserSeq1, UserSeq2, CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMI CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMI ************************************************************ UserSeq1, UserSeq2, 61 QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVR 61 QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVR ************************************************************ UserSeq1, 121 KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE UserSeq2, 121 KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE ******************************************** Hình 4.7: Kết so sánh trình tự acid amin Kết cho thấy trình tự acid amin đoạn gen tổng hợp đƣợc tƣơng đồng với trình tự acid amin ngân hàng gen NCBI 100 % Footer Page 39 of 134 Header Page 40 of 134 30 PHẦN V KẾT LUẬN VÀ ĐỀ NGHỊ 5.1 Kết luận Từ kết thu đƣợc có kết luận sau: - Tối ƣu hóa đƣợc quy trình tổng hợp gen IFN-α2a kỹ thuật PCR - Tạo dòng thành công gen IFN-α2a vi khuẩn E coli thu nhận đƣợc trình tự DNA mã hóa để nhận đƣợc trình tự acid amin phục vụ cho nghiên cứu 5.2 Đề nghị Trong khóa luận tổng hợp thành công gen IFN-α2a, đồng thời kết giải trình tự cho thấy trình tự acid amin Từ có số đề nghị nhƣ sau: - Thực chuyển gen IFN-α2a vào vector biểu chuyển vào E coli phù hợp cho sản xuất interferon - Tiếp tục nghiên cứu biểu gen IFN-α2a E coli Footer Page 40 of 134 Header Page 41 of 134 31 TÀI LIỆU THAM KHẢO Tài liệu tiếng Việt Bùi Chí Bửu – Nguyễn Thị Lang, 1999 Di truyền phân tử - Những nguyên tắc chọn giống trồng Nhà xuất Nông nghiệp TP Hồ Chí Minh Hồ Huỳnh Thùy Dƣơng, 1998 Sinh học phân tử Nhà xuất Giáo Dục Nguyễn Thị Lang, 2002 Phương pháp nghiên cứu công nghệ sinh học Nhà xuất Nông Nghiệp Nguyễn Thị Lang Bùi Chí Bửu, 2005 Sinh học phân tử giới thiệu phương pháp ứng dụng Nhà xuất Nông Nghiệp Phạm Hoàng Phiệt, 1999 Miễn dịch sinh lý bệnh (tập 1) Nhà xuất thành phố Hồ Chí Minh Bùi Trang Việt, 2002 Bài giảng sinh học phân tử (chương trình cao học) Nhà xuất đại học quốc gia thành phố Hồ Chí Minh Tài liệu nƣớc T.A Brown, 1997 Gene cloning an introduction (third edition) Chapman and Hall Daniel j.j Carr, 2005 Interferon methods and protocols Humana Press Totowa, New Jersey Eric Dieperink, M.D., Mark Willenbring, M.D and Samuel B Ho, M.D Neuropsychiatric Symptoms Associated With Hepatitis C and Interferon Alpha: A Review Am J Psychiatry 157:867-876, June 2000 10 Fernanda O Neves et al Overexpression of a synthetic gene encoding human alpha interferon in Escherichia coli Protein Expression and PuriWcation 35 (2004) 353–359 11 DV Goeddel, H M Shepard, E Yelverton, D Leung, R Crea, A Sloma, and S Pestka Synthesis of human fibroblast interferon by E coli Nucleic Acids Res 1980 September 25; 8(18): 4057–4074 12 Isaacs, A and Lindenmam, J Virus interference I The interferon Proc R Lond B Biol Sci 174, 258 Footer Page 41 of 134 Header Page 42 of 134 32 13 M.J McPherson and S.G Møller, 2000 PCR Springer 14 Mullis K et al Specific enzymatic amplification of DNA in vitro: The polymerase chain reaction Cold Spring Harbor Symn Quant Biol.51: 263-273 15 Poonam Srivastava et al Overexpression and purification of recombinant human interferon alpha2b in Escherichia coli Protein Expression and Purification 41 (2005) 313–322 16 F H Reynolds, JR., E Premkumart, and P M Pitha Interferon activity produced by translation of human interferon messenger RNA in cell-free ribosomal systems and in Xenopus oocytes Proc Nat Acad Sci USA Vol 72, No 12, pp 4881-4885, December 1975 Biochemistry 17 Sambrook and Russell Molecular cloning - Laboratory manuals, volume Cold Spring Harbor Laboratory Press, New York 18 Scott M Lippman 13-cis-Retinoic Acid and Interferon -2a: Effective Combination Therapy for Advanced Squamous Cell Carcinoma of the Skin Journal of the National Cancer Institute, Vol 84, No 4, 235-241, February 19, 1992 19 Spiegel RJ Intron A (Interferon Alfa-2B): clinical overview and future directions Seminars in Oncology 13(3, Suppl 2): 89-101, 1986 20 Woojin Jeong and Hang-Cheol Shin Supply of the argU gene product allows high-level expression of recombinant human interferon-a2a in Escherichia coli Biotechnology Letters, Vol 20, No 1, January 1998, pp 19–22 Tài liệu web http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=Nucleotide&dopt=GenBank &val=11067750 http://www.biochemeng.bio.titech.ac.jp/image/phage.jpg http://www.bioon.com/experiment/UploadFiles/200412/20041221004623826.jpg http://nsm1.utdallas.edu/bio/gonzalez/fall05/LECTURE07(OVERHEAD)_files/image 024.jpg http://www.roche.com/pages/facets/10/interferon3de.jpg Footer Page 42 of 134 Header Page 43 of 134 33 PHỤ LỤC Phụ lục : Kết đọc trình tự từ Macrogen Hàn Quốc >060308-02_N16_pGEM-2a-7-T7promoter.ab1 855 855 ABI NNNNAACGGCTATCGAGCTCCGGCCGCCTGGCCGCGGGATTTGCGGCCGC TCTAGATTATTCCTTACTACGCAGGCTTTCCTGCAGGTTGGTGCTCAGGC TAAAGCTACGCATGATTTCCGCACGAACAACTTCCCACGCGCACGGGCTA TATTTTTTTTCTTTCAGATACAGGGTGATACGCTGAAAATATTTACGAAC CGCCAGGATGCTATCTTCTTTCATCAGCGGGGTTTCGGTAACGCCAACGC CCTGGATAACGCACGCTTCCAGATCGTTCAGCTGCTGATACAGTTCGGTA TAAAATTTATCCAGCAGGGTTTCATCCCACGCCGCGCTGCTATCTTTGGT GCTAAACAGGTTAAAGATCTGCTGGATCATTTCATGCAGAACCGGGATGG TTTCCGCTTTCTGAAACTGGTTGCCAAATTCTTCCTGCGGAAAGCCAAAA TCATGACGATCTTTCAGGCAGCTAAACAGGCTGATTTTACGCATCTGCGC CAGCAGCATCAGGGTACGACGGCTGCCCAGGCTATGGGTTTGAGGCAGAT CACATCTTTTCTCGAGAAATCACTAGTGCGGCCGCCTGCAGGTCGACCAT ATGGGAGAGCTCCCAACGCGTTGGATGCATAGCTTGAGTATTCTATAGTG TCACCTAAATAGCTTGGCGTAATCATGGTCATAGCTGTTTCCTGTGTGAA ATTGTTATCCGCTCACAATTCCACACAACATACGAGCCGGAAGCATAAAG TGTAAAGCCTGGGGTGCCTAATGAGTGAGCTAACTCACATAAATGCGNTG CGCTCACTGCCCNGCTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCATTA ATGAN Footer Page 43 of 134 Header Page 44 of 134 Footer Page 44 of 134 34 ...Header Page of 134 BỘ GIÁO DỤC VÀ ĐÀO TẠO TRƢỜNG ĐẠI HỌC NÔNG LÂM TP.HCM BỘ MÔN CÔNG NGHỆ SINH HỌC ***000*** TỔNG HỢP VÀ TẠO DÕNG PHÂN TỬ GEN INTERFERON ALPHA 2A Luận văn kỹ sƣ Chuyên ngành:... dụng interferon nhập từ nƣớc giá thành cao so với mức sống ngƣời dân Vì lý định thực đề tài này: Tổng hợp tạo dòng phân tử gen interferon alpha 2a 1.2 MỤC TIÊU VÀ YÊU CẦU 1.2.1 Mục tiêu Tổng hợp. .. 8/2006, “TỔNG HỢP VÀ TẠO DÒNG PHÂN TỬ GEN INTERFERON ALPHA 2A ” Hƣớng dẫn khoa học: ThS Trần Quỳnh Hoa Đề tài đƣợc tiến hành từ ngày 06-02-2006 đến ngày 31-07-2005 phòng thí nghiệm sinh học phân tử
- Xem thêm -

Xem thêm: TỔNG HỢP VÀ TẠO DÕNG PHÂN TỬ GEN INTERFERON ALPHA 2A, TỔNG HỢP VÀ TẠO DÕNG PHÂN TỬ GEN INTERFERON ALPHA 2A, TỔNG HỢP VÀ TẠO DÕNG PHÂN TỬ GEN INTERFERON ALPHA 2A

Gợi ý tài liệu liên quan cho bạn

Nhận lời giải ngay chưa đến 10 phút Đăng bài tập ngay
Nạp tiền Tải lên
Đăng ký
Đăng nhập