Nghiên cứu xác định tỷ lệ nhiễm và độc tố đường ruột (enterotoxin) của vi khuẩn Listeria, Salmonella spp., Staphylococcus aureus ô nhiễm trong thịt lợn ở một số tỉnh phía Bắc (LA tiến si)

187 238 1
  • Loading ...
1/187 trang
Tải xuống

Thông tin tài liệu

Ngày đăng: 25/04/2017, 15:18

Nghiên cứu xác định tỷ lệ nhiễm và độc tố đường ruột (enterotoxin) của vi khuẩn Listeria, Salmonella spp., Staphylococcus aureus ô nhiễm trong thịt lợn ở một số tỉnh phía Bắc (LA tien si)Nghiên cứu xác định tỷ lệ nhiễm và độc tố đường ruột (enterotoxin) của vi khuẩn Listeria, Salmonella spp., Staphylococcus aureus ô nhiễm trong thịt lợn ở một số tỉnh phía Bắc (LA tien si)Nghiên cứu xác định tỷ lệ nhiễm và độc tố đường ruột (enterotoxin) của vi khuẩn Listeria, Salmonella spp., Staphylococcus aureus ô nhiễm trong thịt lợn ở một số tỉnh phía Bắc (LA tien si)Nghiên cứu xác định tỷ lệ nhiễm và độc tố đường ruột (enterotoxin) của vi khuẩn Listeria, Salmonella spp., Staphylococcus aureus ô nhiễm trong thịt lợn ở một số tỉnh phía Bắc (LA tien si)Nghiên cứu xác định tỷ lệ nhiễm và độc tố đường ruột (enterotoxin) của vi khuẩn Listeria, Salmonella spp., Staphylococcus aureus ô nhiễm trong thịt lợn ở một số tỉnh phía Bắc (LA tien si)Nghiên cứu xác định tỷ lệ nhiễm và độc tố đường ruột (enterotoxin) của vi khuẩn Listeria, Salmonella spp., Staphylococcus aureus ô nhiễm trong thịt lợn ở một số tỉnh phía Bắc (LA tien si)Nghiên cứu xác định tỷ lệ nhiễm và độc tố đường ruột (enterotoxin) của vi khuẩn Listeria, Salmonella spp., Staphylococcus aureus ô nhiễm trong thịt lợn ở một số tỉnh phía Bắc (LA tien si)Nghiên cứu xác định tỷ lệ nhiễm và độc tố đường ruột (enterotoxin) của vi khuẩn Listeria, Salmonella spp., Staphylococcus aureus ô nhiễm trong thịt lợn ở một số tỉnh phía Bắc (LA tien si)Nghiên cứu xác định tỷ lệ nhiễm và độc tố đường ruột (enterotoxin) của vi khuẩn Listeria, Salmonella spp., Staphylococcus aureus ô nhiễm trong thịt lợn ở một số tỉnh phía Bắc (LA tien si) BỘ GIÁO DỤC & ĐÀO TẠO ĐẠI HỌC THÁI NGUYÊN ĐẶNG THỊ MAI LAN NGHIÊN CỨU XÁC ĐỊNH TỶ LỆ NHIỄM VÀ ĐỘC TỐ ĐƯỜNG RUỘT (ENTEROTOXIN) CỦA VI KHUẨN Listeria, Salmonella spp., Staphylococcus aureus Ô NHIỄM TRONG THỊT LỢN Ở MỘT SỐ TỈNH PHÍA BẮC LUẬN ÁN TIẾN SĨ THÚ Y Thái Nguyên, năm 2017 BỘ GIÁO DỤC & ĐÀO TẠO ĐẠI HỌC THÁI NGUYÊN ĐẶNG THỊ MAI LAN NGHIÊN CỨU XÁC ĐỊNH TỶ LỆ NHIỄM VÀ ĐỘC TỐ ĐƯỜNG RUỘT (ENTEROTOXIN) CỦA VI KHUẨN Listeria, Salmonella spp., Staphylococcus aureus Ô NHIỄM TRONG THỊT LỢN Ở MỘT SỐ TỈNH PHÍA BẮC Chuyên ngành: Ký sinh trùng & VSV học thú y Mã số: LUẬN ÁN TIẾN SĨ THÚ Y Người hướng dẫn khoa học: PGS.TS Đặng Xuân Bình PGS.TS Nghiêm Ngọc Minh Thái Nguyên, năm 2017 i LỜI CAM ĐOAN Tôi xin cam đoan công trình nghiên cứu riêng thực với giúp đỡ của: - Ths Phạm Thị Phương Lan anh, chị, em Bộ môn Công nghệ vi sinh - Viện Khoa học sống - Đại học Thái Nguyên - Ths Nguyễn Thị Hoài Thu toàn thể anh, chị, em phòng Công nghệ sinh học môi trường phòng thí nghiệm trọng điểm Công nghệ gen - Viện Công nghệ sinh học Các số liệu, kết nêu luận án trung thực chưa công bố công trình khác Tôi xin cam đoan thông tin trích dẫn luận án rõ nguồn gốc Thái Nguyên, ngày tháng Tác giả Đặng Thị Mai Lan năm 2017 ii LỜI CẢM ƠN Để hoàn thành luận án này, với nỗ lực, cố gắng thân, xin đặc biệt bày tỏ lòng biết ơn sâu sắc tới thầy: PGS.TS Đặng Xuân Bình PGS.TS Nghiêm Ngọc Minh, người trực tiếp hướng dẫn truyền đạt nhiều kinh nghiệm quý báu cho trình nghiên cứu hoàn thành luận án Tôi xin chân thành cảm ơn tới Ths Phạm Thị Phương Lan anh, chị, em Bộ môn Công nghệ vi sinh - Viện Khoa học sống - Đại học Thái Nguyên giúp đỡ tạo điều kiện cho hoàn thành luận án Tôi xin gửi lời cảm ơn tới Ths Nguyễn Thị Hoài Thu toàn thể anh, chị, em phòng Công nghệ sinh học môi trường phòng thí nghiệm trọng điểm Công nghệ gen - Viện Công nghệ sinh học tận tình giúp đỡ tạo điều kiện trình nghiên cứu hoàn thiện luận án Nhân dịp xin trân trọng cảm ơn Ban Giám hiệu nhà trường, Ban Chủ nhiệm khoa Chăn nuôi thú y, thầy cô, anh chị em đồng nghiệp khoa Chăn nuôi thú y, Lãnh đạo Chi cục Thú y, Trạm thú y tỉnh Thái Nguyên, Bắc Giang, Hà Tây - Hà Nội, Vĩnh Phúc tạo điều kiện tốt để hoàn thành luận án Lời sau cùng, xin bày tỏ lòng biết ơn chân thành tới người bạn, người thân gia đình bố, mẹ kịp thời động viên tạo điều kiện thuận lợi để hoàn thành luận án Xin cảm ơn người chồng thân yêu giúp đỡ, chia sẻ với suốt năm tháng qua Xin trân trọng cảm ơn tất giúp đỡ quý báu Thái Nguyên, ngày tháng năm 2017 Đặng Thị Mai Lan iii MỤC LỤC LỜI CAM ĐOAN i LỜI CẢM ƠN ii MỤC LỤC iii DANH MỤC CÁC CHỮ VIẾT TẮT .xiii APS: xiii AOAC: .xiii bp: xiii base pair (cặp base) xiii C perfringens: xiii Clostridium perfringens xiii DBB: xiii Denaturing Binding Buffer .xiii DEB: xiii Denaturing Elution Buffer xiii ADN: xiii Acid deoxyribonucleic .xiii dNTPs: .xiii deoxynucleotide triphosphate xiii E coli: .xiii Escherichia coli xiii EDTA: .xiii Ethylene Diamine Tetraacetace Acid .xiii Epp: xiii Eppendorf xiii Isopropyl β-D-1-thiogalactopyranoside xiii LB: xiii Luria and Bertani .xiii Histocompatibility complex class II xiii Methicillin-resistant Staphylococcus aureus xiii Methicillin‐ sensitive Staphylococcus aureus xiii Ngân hàng gen xiii Ngộ độc thực phẩm xiii iv PCR: xiii Polymerase Chain Reaction xiii PBS: xiii Phosphate buffer saline .xiii S aureus: xiii Staphylococcal chromosomal cassette xiii SDS: xiii Sodium dodecyl sulfate .xiii se: xiii Staphylococcal enterotoxin .xiii sea: xiii Staphylococcal enterotoxin A xiii seb: xiii Staphylococcal enterotoxin B xiii sec: xiii Staphylococcal enterotoxin C xiii sed: xiii Staphylococcal enterotoxin D xiii see: xiii Staphylococcal enterotoxin E xiii ses: xiii Staphylococcal enterotoxin S xiii set: xiv Staphylococcal enterotoxin T xiv Staphylococcal enterotoxin B 534 xiv SMX/TMD: .xiv Sulfamethoxazole – Trimethoprim xiv RNA: xiv Ribonucleic Acid .xiv Pulsed-field gel electrophoresis xiv Peptidoglycan xiv TEMED: xiv Toll-like receptor .xiv TSST: xiv v v/p: xiv Vòng/phút xiv VKHK: .xiv Vi khuẩn hiếu khí xiv UBND: .xiv Ủy ban nhân dân xiv DANH MỤC CÁC BẢNG, BIỂU .xv DANH MỤC CÁC HÌNH xxii MỞ ĐẦU 1 Tính cấp thiết đề tài Mục tiêu nghiên cứu Ý nghĩa khoa học thực tiễn đề tài 3.1 Ý nghĩa khoa học 3.2 Ý nghĩa thực tiễn Điểm đề tài Chương TỔNG QUAN TÀI LIỆU 1.1 Tình hình ngộ độc thực phẩm nhiễm vi khuẩn Listeria, Salmonella spp Staphylococcus aureus giới Việt Nam .4 1.1.1 Tình hình ngộ độc thực phẩm nhiễm vi khuẩn Listeria, Salmonella spp S aureus giới 1.1.2 Tình hình ngộ độc thực phẩm nhiễm vi khuẩn Listeria, Salmonella spp S aureus Việt Nam 1.2 Ngộ độc thực phẩm nhiễm Listeria, Salmonella spp., S aureus nguyên nhân gây nhiễm khuẩn vào thịt lợn .10 1.2.1 Khái niệm ngộ độc phân loại tình trạng ngộ độc .10 1.2.2 Ngộ độc thực phẩm Listeria, Salmonella spp Stapylococccus aureus 10 Ngộ độc thực phẩm Listeria 10 Ngộ độc thực phẩm Salmonella spp .11 Ngộ độc thực phẩm Staphylococcus aureus 11 1.2.3 Nguyên nhân gây nhiễm khuẩn vào thịt 12 Nguyên nhân từ thể động vật 12 Nguyên nhân từ nguồn nước sản xuất 13 Nguyên nhân từ không khí 13 Nguyên nhân từ dụng cụ, trang thiết bị không đảm bảo vệ sinh 13 vi Nguyên nhân từ người trực tiếp giết mổ 14 Nguyên nhân vận chuyển 14 Nguyên nhân thời gian nơi bày bán 15 1.3 Đặc điểm sinh vật, hóa học số vi khuẩn gây ô nhiễm thịt lợn 15 1.3.1 Sơ đồ phân lập vi khuẩn Listeria, Salmonella spp S aureus 15 Phân loại vi khuẩn Listeria 16 Phân loại vi khuẩn Salmonella spp .16 Phân loại vi khuẩn Staphylococcus aureus 17 1.3.2 Đặc điểm sinh vật, hóa học vi khuẩn Listeria 20 Đặc điểm hình thái 20 Đặc tính nuôi cấy .20 Đặc tính sinh hóa 21 Sức đề kháng .21 Khả kháng kháng sinh .22 Đặc tính gây bệnh 22 1.3.3 Đặc điểm sinh vật, hóa học vi khuẩn Salmonella spp 23 Đặc điểm hình thái 23 Đặc tính nuôi cấy .23 Đặc tính sinh hóa 24 Sức đề kháng .26 Khả kháng kháng sinh .26 Đặc tính gây bệnh 27 1.3.4 Đặc điểm sinh vật, hóa học vi khuẩn Staphylococcus aureus 28 Đặc điểm hình thái 28 Đặc tính nuôi cấy .28 Đặc tính sinh hóa 29 (Reginald W B Gayle A L., 2001 [124]) 30 Khả đề kháng 30 Khả kháng kháng sinh .31 Đặc tính gây bệnh 32 1.4 Các yếu tố độc lực vi khuẩn Listeria, Salmonella spp S aureus 32 1.4.1 Các yếu tố độc lực vi khuẩn Listeria 32 Cấu tạo kháng nguyên 32 Độc tố - yếu tố độc lực vi khuẩn .33 1.4.2 Các yếu tố độc lực vi khuẩn Salmonella spp 33 Cấu tạo kháng nguyên 33 Độc tố - yếu tố độc lực vi khuẩn Salmonella spp 36 Plasmid - yếu tố di truyền khả sản sinh độc tố 38 1.4.3 Các yếu tố độc lực vi khuẩn S aureus .39 Cấu trúc kháng nguyên .39 Độc tố S aureus 39 vii 1.5 Gene sản sinh độc tố vi khuẩn Salmonella spp Staphylococcus aureus 44 1.5.1 Gene sản sinh độc tố đường ruột Salmonella spp 44 1.5.2 Gene sản sinh độc tố đường ruột Staphylococcus aureus 45 1.6 Biện pháp phòng chống ngộ độc thực phẩm 49 1.6.1 Giải pháp trước mắt 49 Giải pháp chăn nuôi (theo VietGap) 49 Các giải pháp kỹ thuật 50 * Tăng cường trang thiết bị chẩn đoán nhanh 51 Các giải pháp quản lý 51 Các giải pháp xã hội 51 1.6.2 Giải pháp lâu dài .52 Chương 53 ĐỐI TƯỢNG, VẬT LIỆU, NỘI DUNG VÀ PHƯƠNG PHÁP NGHIÊN CỨU 53 2.1 Đối tượng phạm vi nghiên cứu .53 2.1.1 Đối tượng nghiên cứu .53 2.1.2 Địa điểm nghiên cứu .53 - Địa điểm phân tích mẫu: 53 + Bộ môn Vi sinh - Viện Khoa học Sự sống - Đại học Thái Nguyên .53 2.1.3 Thời gian nghiên cứu: Từ năm 2012 đến năm 2015 .53 2.2 Vật liệu nghiên cứu 53 2.2.1 Động vật thí nghiệm .53 2.2.2 Các loại môi trường, hóa chất thiết bị sử dụng trình nghiên cứu 53 - Máy móc, dụng cụ: thuộc phòng thí nghiệm Bộ môn Vi sinh - Viện Khoa học Sự sống - Đại học Thái Nguyên Ngoài ra, hóa chất thiết bị dùng cho sinh học phân tử Phòng Công nghệ sinh học môi trường Phòng thí nghiệm trọng điểm Công nghệ gen - Viện Công nghệ sinh học .54 2.3 Nội dung nghiên cứu 55 2.3.1 Xác định tỷ lệ nhiễm đặc tính sinh học vi khuẩn Listeria, Salmonella spp S aureus thịt lợn tươi bán chợ Trung tâm số tỉnh phía Bắc 55 - Tỷ lệ nhiễm vi khuẩn Listeria, Salmonella spp., S aureus thịt lợn bán chợ Trung tâm số tỉnh phía Bắc 55 - Xác định đặc tính sinh hóa chủng vi khuẩn phân lập 55 - Xác định tính mẫn cảm chủng vi khuẩn phân lập số loại kháng sinh 55 viii 2.3.3 Xác định khả sản sinh độc tố đường ruột vi khuẩn Salmonella spp S aureus “Phản ứng khuếch tán da thỏ” 55 2.3.4 Xác định gene sản sinh độc tố enterotoxin vi khuẩn Salmonella spp S aureus phân lập 55 2.4 Phương pháp nghiên cứu .56 2.4.1 Phương pháp lấy mẫu .56 2.4.2 Phương pháp xác định tiêu vi khuẩn Listeria, Salmonella spp S aureus nhiễm thịt lợn 56 2.4.3 Phương pháp nhuộm Gram xác định hình thái vi khuẩn 59 2.4.4 Xác định đặc tính sinh hóa chủng Listeria, Salmonella spp S aureus phân lập .59 2.4.5 Phương pháp xác định độc lực chủng vi khuẩn Listeria, Salmonella spp S aureus phân lập chuột thí nghiệm 62 2.4.6 Phương pháp xác định tính mẫn cảm với số loại kháng sinh chủng vi khuẩn Listeria, Salmonella spp S aureus phân lập .63 2.4.7 Phương pháp xác định serovar vi khuẩn Salmonella spp phân lập 64 2.4.8 Phương pháp xác định khả sản sinh độc tố đường ruột vi khuẩn Salmonella spp S aureus “Phản ứng khuếch tán da thỏ” 65 2.4.9 Xác định gene sản sinh độc tố đường ruột enterotoxin vi khuẩn Salmonella spp S aureus phương pháp PCR 66 Phương pháp tách ADN mang gene mã hóa sản sinh độc tố đường ruột 66 Phương pháp PCR để nhân gene đích 67 Phương pháp tinh ADN từ gel agarose .68 2.4.10 Phương pháp đọc trình tự ADN máy đọc tự động phân tích kết phần mềm chuyên dụng vi khuẩn S aureus .69 2.4.11 Phương pháp biểu tinh gene seb 534 vi khuẩn S aureus 69 Phân lập gene wtSEB 69 Thiết kế vector biểu 70 Biểu gene wtSEB .70 Chủng tái tổ hợp nuôi môi trường Luria Broth (LB) lỏng có bổ sung kháng sinh ampicillin 100 mg/l (LBA) nhiệt độ 37oC, lắc 200 vòng/phút qua đêm Chuyển % dịch tế bào nuôi cấy qua đêm sang môi trường LBA, tiếp tục nuôi lắc điều kiện 37oC, 200 vòng/phút đến mật độ tế bào (OD600) đạt khoảng 0,5 đến 0,8 Bổ sung chất cảm ứng IPTG đến nồng độ cuối mM tiếp tục nuôi lắc 200 vòng/phút 28oC để cảm ứng tế bào tổng hợp protein ngoại lai Sau 141 82 Fueyu J M., Martin M C., Gonzalez - Hevia M A., Mendoza M C (2000), “Enterotoxin production and DNA fingerprinting in Staphylococcus aureus isolated from human and food samples Relations between genetic types and enterotoxins”, International Journal of Food Microbiology, 67, pp 139 - 145 83 Gill S R., Fouts D E., Archer G L., Mongodin E F., Deboy R T., Ravel J., Paulsen I T., Kolonay, J F., Brinkac L., Beanan M., Dodson R J., Daugherty S C., Madupu R., Angiuoli S V., Durkin A S., Haft D H., Vamathevan J., Khour I H., Utterback T., Lee C., Dimitrov G., Jiang L., Qin H., Weidman J., Tran K., Kang K., Hance I R., Nelson K E., Fraser C M (2005), “Insights on evolution of virulence and resistance from the complete genome analysis of an early methicillin-resistant Staphylococcus aureus strain and a biofilmproducing methicillin-resistant Staphylococcus epidermidis strain”, Journal of Bacteriology, 187, pp 2426 - 2438 84 Greenfield R A., Brown B R., Huntchins J B., Iandolo J J., Jackson R., Slater L N., Bronze M S (2002), “Microbiological, biological and chemical weapons of warfare and terrorism”, The American Journal of the Medical Science, 323(6), pp 326 - 340 85 Haeghebaert S., Le Q F., Gallay A., Bouvet P., Gomez M., Vaillant V (2002), Les toxi-infections alimentaires collectives en France, en 1999 et 2000, Bull Epidémiol Hebdo, 23, pp 105 - 109 86 Haghjoo E., Galan J E (2004), Salmonella typhy encodes a functional cytolethal distending toxin that is delivered into host cells by a bacterial - internalization pathway, Section of Microbial Pathogenesis, Yale University School of Medicine, New Haven, CT 06536, USA 87 Hangan, Bruner (1981), “Infection discaser of metie animals”, Seven edition, Puplished by Cornell University press Ltd, pp 164 - 168 88 Hao D., Xing X., Li G., Wang X., Zhang W., Xia X., Meng J (2015), “Prevalence, toxin gene profiles and antimicrobial resistance of Staphylococcus aureus isolated from quick - frozen dumplings”, Journal of Food Protection, 78 (1), pp 218 - 223 142 89 Harvey J., Gilmour A (2000), Staphylococcus aureus, In: (Eds.) Robinson R K., Batt C A., Patel P D Encyclopedia of food microbiology Academic Press, London, pp 2066 - 2071 90 He W., Lui Y., Qi J., Chen H., Zhao C., Zhang F., Li H., Wang H (2013), “Food animal related Staphylococcus aureus multidrug resistant ST9 strains with toxin genes”, Foodborne Pathogens Disease, 10(9), pp.782 - 788 91 Herron O L., Fitzgerald J R., Musser J M., Kapur V (2007), “Molecular correlates of host specialization in Staphylococcus aureus”, PLoS ONE, (10), pp 1120 92 Holden M T., Feil E J., Lindsay J A., Peacock S J., Day N P., Enright M C., Foster T J., Moore C E., Hurst L., Atkin R., Barron A., Bason N., Bentley S D., Chilling W C., Chilling W T., Churcher C., Clark L., Corton C., Cronin A., Doggett J., Dowd L., Feltweel T., Hance Z., Harris B., Hauser H., Holroyd S., Jagels K., James K D., Lennard N., Line A., Mayes R., Moule S., Mungall K., Ormond D., Quail M A., Rabbinowitsch E., Rutherford K., Sanders M., Sharp S., Simmonds M., Stevens K., Whitehead S., Barell B G., Spratt B G., Parkhill J (2004), “Complete genomes of two clinical Staphylococcus aureus strains: evidence for the rapid evolution of virulence and drug resistance”, Proceedings of the National Academy of Sciences, 101(26), pp 9786 - 9791 93 Jamali H., Radmehr B., Ismail S (2014), “Prevalence and antimicrobial resistance of Listeria, Salmonella, and Yersinia species isolates in ducks and geese”, Poultry Science, 93(4), pp 1023 - 1030 94 Jay J M (2000), Modern food Microbiology, An Arpen publication, Maryland, pp 511 - 528 95 Jogensen H J., Mork T., Hogasen H R., Rorvik L M (2004), “Enterotoxigenic Staphylococcus aureus in bulk in Norway”, Journal of Applied Microbiology, 99, pp 158 - 166 96 Jones G W, Richardson A J (1981), “The attachment to of hela cells by S typhimurium the contribution of manose sensitive and manose - sensitive haemaglutimate activities”, Journal of General Microbiology, 127, pp 361 - 370 97 Kenneth Todar (2005), Salmonella and Salmonellosis, University of Wisconsin -Madison Department of Bacteriology 143 98 Kumarss Amini, Taghi Zahraei Salehi, Gholamreza Nikbakht, Reza Ranjbar, Javid Amini, Shahrnaz Banou Ashrafganjooei (2010), “Molecular detection of invA and spv virulence genes in Salmonella enteritidis isolated from human and animals in Iran”, African Journal of Microbiology Research, (21), pp 2202 - 2210 99 Krause M., Fang F C., El-Gedaily A., Libby S., Guiney D G (1995), Mutational analysis of SpvR binding to DNA in the regulation of the Salmonella plasmid virulence operon, Plasmid 34 (1), pp 37 - 47 100 Kraushaar B., Fetsch A (2014), “First description of PVL-positive methicillinresistant Staphylococcus aureus (MRSA) in wild boar meat”, International Journal of Food Microbiology, 186, pp 68 - 73 101 Lado B., Yousef A E (2007), Characteristics of Listeria monocytogenes important to food processors Ch In: Ryser ET, Marth EH (eds) Listeria, listeriosis and food safety, CRC Press Taylor & Francis Group, Boca Raton, pp 157 - 213 102 Lai J., Wu C., Qi J., Wang Y., Wang H., Liu Y., Shen J (2014), “Serotype distribution and antibiotic resistance of Salmonella in food-producing animals in Shandong province of China, 2009 and 2012”, International Journal of Food Microbiology, 180, pp 30 - 38 103 Letertre C., Perelle S., Dilasser F., Fach P (2003), “Identification of a new putative enterotoxin SEU encoded by the egc cluster of Staphylococcus aureus”, Journal of Food Microbiology, 95, pp 38 - 43 104 Li Y C., Pan Z M., Kang X L., Geng S Z., Liu Z Y., Cai Y Q., Jiao X A (2014), “Prevalence, characteristics, and antimicrobial resistance patterns of Salmonella in retail pork in Jiangsu province, eastern China”, Journal of Food Protection, 77 (2), pp 236 - 245 105 Lopes G V., Pissetti C., Crus Payão Pellegrini D., Silva L E., Cardoso M (2014), ‘Resistance phenotypes and genotypes of Salmonella enterica subsp enterica isolates from feed, pigs, and carcasses in Brazil”, Journal of Food Protection, 78 (2), pp 407 - 413 144 106 Mary K Sandel, John L McKillip (2002), “Virulence and recovery of Staphylococcus aureus to the food industry using improvement on traditional approaches”, Food Control, 15, pp - 10 107 Meyer C., Fredriksson - Ahomaa M., Sperner B., Märtlbauer E (2011), “Detection of Listeria monocytogenes in pork and beef using the VIDAS® LMO2 automated enzyme linked immunoassay method”, Meat Science, pp 594 - 596 108 Mihaiu L., Lapusan A., Tanasuica R., Sobolu R., Mihaiu R., Oniga O., Mihaiu M (2014), “First study of Salmonella in meat in Romania”, Journal of Infection in Developing Countries, (1), pp 50 - 58 109 Murray E., Webb R., Swann M (1926), A disease of rabbits characterized by a large mononuclear leucocytosis, caused by a hitherto undescribed bacillus Bacterium monocytogenes (n sp.), Journal of Pathology and Bacteriology 29, pp 289 - 292 110 Muller W H., Trust T J., Kay W W (1989), “Fimbriation genes of Salmonella enteritidis”, Journal of Bacterology, Washington DC 20036, pp 4648 - 4654 111 Naomi Balaban, Avraham Rasooly (2000), “Staphylococcal enterotoxins” International Journal of Food Microbiology, 61, pp - 10 112 NCCLS (2000), Performance standards for antimicrobial disk susceptibility tests, Approved standard, seventh edition edn, Pennsylvania, USA: The National Commintte for Clinical Laboratory Standards, pp - 10 113 Nema V., Agrawal R., Kamboj D V., Goel A K., Singh L (2007), “Isolation and characterization of heat resistant enterotoxigenic Staphylococcus aureus from a food poisoning outbreak in Indian subcontinent”, International Journal of Food Microbiology, 117(1), pp 29 - 35 114 Ng D L K., Tay L (1992), “Enterotoxigenic strains of coagulase-positive Staphylococcus aureus in drinks and ready-to-eat foods”, Food Microbiology, 10, pp 317 - 320 115 Norinaga Miwa, Asako Kawamura, Takashi Masuda, Masato Akiyama (2000), “An outbreak of food poisoning due to egg yolk reaction-negative Staphylococcus aureus”, International Journal of Food Microbiology, 64, pp 361 - 366 145 116 Ono H K., Omoe K., Imanishi K., Iwakabe Y., Hu D L., Kato H (2008), “Identification and characterization of two novel staphylococcal enterotoxins, types S and T”, Infection and Immunity, 76 (11), pp 4999 - 5005 117 Orskov I., Orskov F., Jann B., Jann K (1977), Serology, chemistry, and genetics of O and K antigens of Escherichia coli, Bacteriological Reviews 41, pp 667 - 710 118 Peterson J W (1980), Salmonella toxin, Pharm A ther VII, pp 719-724 119 Pinto B., Chenoll E., Azna R (2004), “Identification and typing of food-borne Staphylococcus aureus by PCR-based techniques”, Systematic and Applied Microbiology, 28, pp 340 - 350 120 Popoff M Y., Le Minor L (1997), Antigenic Formulas of the Salmonella Serovars, 7th revn, WHO Collaborating Centre for Reference and Research on Salmonella, Institut Pasteur, Paris, France 121 Quinn P J., Carter M E., Makey B K., Carter G R (1994), Clinical Veterinary Microbiology, Wolfe publishing, Mosby - Year book Europe Limited, Edinburgh 122 Quinn P J., Carter M E., Makey B K., Carter G R (2002), Clinical veterinary microbiology, Wolfe Pulishing, London WC1 H9LB 123 Rebiahi S A., Abdelouahida D E., Rahmoun M., Abdelali S., Azzaoui H (2011), “Emergence of vancomycinresistant Staphylococcus aureus identified in the Tiemcen university hospital (North-West Algeria)”, Medecine et Maladies Infectieuses, 41 (12), pp 46 - 51 124 Reginald W Bennett, Gayle A Lancette (2001), Bacteriological Analytical Manual Online (Chapter12: Staphylococcus aureus), Center for Food Safety & Applied Nutrition, U.S.Food and Drug Administration 125 Reimeyer J C., Peterson J M., Wilson K J (1986), Salmonella cytotoxin: a component of the bacterial outer membrane, Microbiology Pathogenic, 1, pp 503 - 510 126 Rosec J P., Gigaud O (2002), “Staphylococci enterotoxin genes of classical and new types detected by PCR in France”, International Journal of Food Microbiology, 77, pp 61 - 70 146 127 Sambrook J., Russell D W (2001), Molecular Cloning, A laboratory manual, Cold Spring Harbor Laboratory Press, New York 128 Sandefur P D., Peterson J W (1976), “Isolation of skin permeability factors from culture filtrates of Salmonella typhimurium”, Infection and Immunity, 14 (3), pp 671 - 679 129 Schoder D., Strauß A., Szakmary-Brändle K., Stessl B., Schlager S., Wagner M (2014), “Prevalence of major foodborne pathogens in food confiscated from air passenger luggage”, International Journal of Food Microbiology, pp 401 - 402 130 Scott E Martin, John J Iandolo, Harvey J., Gilmour A., Sita R Tatini, Reginald Bennett, Merlin S Bergdoll (2000), Staphylococcus, Encyclopedia of Food Microbiology (Richard K Robinson, Carl A Batt Pradip D Patel), Academic Press, San Diego - San Francisco - New Yolk - Boston - London Sydney - Tokyo, pp 2062 - 2083 131 Simeão Carmo L., Souza Dias R., Roberto Linardi V., Jose de Sena M., Aparecida dos Santos D., Eduardo de Faria M., Castro Pena E., Jett M., Guilherme Heneine L (2001), “Food poisoning enterotoxigenic strains of Staphylococcus present in Minas cheese and raw milk in Brazil”, Food Microbiology, 19, pp - 14 132 Song M., Bai Y., Xu J., Carter M Q., Shi C., Shi X (2014), “Genetic diversity and virulence potential of Satphylococcus aureus isolates from raw and processed food commodities in Shanghai”, International Journal of Food Microbiology, 195, pp - 133 Steven R G., Derrick E F., Gordon L A (2005), “Insights on envolution of virulence and resistance from the complete genome analysis of an early Methicillin Resistant Staphylococcus aureus strain and Biofilm-Producing Methicillin - Resistant Staphylococcus epidermidis strain”, Journal of Bacteriology, 187 (7), pp 2426 - 2438 134 Susana M Portopcarrero, Melissa Newman, Benjy Mikel (2001), “Staphylococcus aureus survival, staphylococci enterotoxin production and shelf stability of country - cured hams manufactured under different processing procedures”, Meat Science, 62, pp 267 - 273 147 135 Tadee P., Boonkhot P., Patchanee P (2014), “Quantification of contamination levels and particular risk of Salmonella spp In pigs in slaughterhouses in Chiang Mai and Lamphun provinces, Thailand”, Japanese Journal of Veterinary Research, 62 (4), pp 171 - 179 136 Taylor D J schlum, Beeren L R., D.O J.T cliver, Bergdol M S (1982), “Emetic action of Staphylococcal enterotoxin A on weanlling pigs”, Infect inmumol, 36 (3), pp 1263 - 1266 137 Tawaratsumida K., Fujimoto F M Y., Fukase K., Suda Y., Hashimoto M (2009), “Characterization of N - terminal structure of TLR2 - activating lipoprotein in Staphylococcus aureus”, Journal of Biological Chemistry, 284, pp 9147 - 9152 138 Vally H., Glass K., Ford L., Hall G., Kirk M D., Shadbolt C., Veitch M., Fullerton K E., Musto J., Becker N (2014), “Proportion of illness acquired by foodborne transmission for nine enteric pathogens in Australia: An Expert Elicitation”, Foodborne Pathogens and Disease, 11(9), pp 727 - 733 139 Vemozy Rozand C., Mazuy Cruchaudet C., Bavai C., Richard Y (2004), “Comparison of three immunological methods for detecting staphylococcal enterotoxin from food”, Letter in Applied Microbiology, 39 (6), pp 1390 - 1394 140 Viktoria Atanmassova, Alexandra Meindl, Christian Ring (2001), “Prevalence of Staphylococcus aureus and staphylococci enterotoxin in raw pork and uncooked smoked ham - a comparison of classical culturing detection and RFLP - PCR”, International Journal of Food Microbiology, 68, pp 105 - 113, 141 Yarwood J M., McCormick J K., Paustian M L., Orwin P M., Kapur V., Schlievert P M (2002), “Characterization and expression analysis of Staphylococcus aureus pathogenicity island Implications for the evolution of staphylococcal pathogenicity islands, Staphylococcus aureus”, Journal of Biological Chemistry, 277 (15), pp 13138 - 13147 142 Yves Le Loir, Florence Baron, Michel Gautier (2003), “Staphylococcus aureus and food poisoning”, Genetic and Molecular Research, (1), pp 63 - 76 143 Walter Chaim, David A Eschenbach (2014), Specific bacterial infections: Listeria, The educational platform for FIGO, The international Federation of Gynecology and Obstetrics 148 144 Wei H L., Chiou C S (2002), Molecular subtyping of Staphylococcus aureus from an outbreak associated with a food handler, Epidemiology and Infection, Cambridge University Press, 128, pp.15 - 20 III Tài liệu Internet 145 Bremer P J., Fletcher G C., Osbome C (2004), Staphylococcus aureus, NewZealand Institute for Crop and Food Research gi|56673482|gb|AY852244.1| Staphylococcus aureus enterotoxin B (seb) gene, partial cds GAGAGTCAACCAGATCCTAAACCAGATGAGTTGCACAAATCGAGTAAAT TCACTGGTTTGATGGAAAATA TGAAAGTTTTGTATGATGATAATCATGTATCAGCAATAAACGTTAAATCT ATAGATCAATTTCTATACTT 153 TGACTTAATATATTCTATTAAGGACACTAAGTTAGGGAATTATGATAATG TTCGAGTCGAATTTAAAAAC AAAGATTTAGCTGATAAATACAAAGATAAATACGTAGATGTGTTTGGAG CTAATTATTATTATCAATGTT ATTTTTCTAAAAAAACGAATGATATTAATTCGCATCAAACTGACAAACGA AAAACTTGTATGTATGGTGG TGTAACTGAGCATAATGGAAACCAATTAGATAAATATAGAAGTATTACT GTTCGGGTATTTGAAGATGGT AAAAATTTATTATCTTTTGACGTACAAACTAATAAGAAAAAGGTGACTGC TCAAGAATTAGATTACCTAA CTCGTCACTATTTGGTGAAAAATAAAAAACTCTATGAATTTAACAACTCG CCTTATGAAACGGGATATAT TAAATTTATAGAAAATGAGAATAGCTTTTGGTATGACATGATGCCTGCAC CAGGAGATAAATTTGACCAA TCTAAATATTTAATGATGTACAATGACAATAAAATGGTTGATTCTAAAGA TGTGAAGATTGAAGTTTATC TTACGACAAAGAAAAAGTGA ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSI KDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDI NSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNK KKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPA PGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK* A segment of gene encoding four desired histidines only (336 nucleotides, 112 codons) TTGCACAAATCGAGTAAATTCACTGGTTTGATGGAAAATA TGAAAGTTTTGTATGATGATAATCATGTATCAGCAATAAACGTTAAATCT ATAGATCAATTTCTATACTT TGACTTAATATATTCTATTAAGGACACTAAGTTAGGGAATTATGATAATG TTCGAGTCGAATTTAAAAAC 154 AAAGATTTAGCTGATAAATACAAAGATAAATACGTAGATGTGTTTGGAG CTAATTATTATTATCAATGTT ATTTTTCTAAAAAAACGAATGATATTAATTCGCATCAAACTGACAAACGA AAAACTTGTATGTATGGTGG TGTAACTGAGCATAAT Primers used for amplifying a segment of gene encoding four desired histidines P - SEB - F: 5’ ATGTTGCACAAATCGAGTAAATTC 3’ (24 mer) P - SEB - R: 5’ TCAATTATGCTCAGTTACACCACC 3’ (24 mer) 155 Phụ lục 2.2: Các vector sử dụng để biểu Vector biểu pET21a+ Vector tách dòng pJET1.2/blunt ... THỊ MAI LAN NGHIÊN CỨU XÁC ĐỊNH TỶ LỆ NHIỄM VÀ ĐỘC TỐ ĐƯỜNG RUỘT (ENTEROTOXIN) CỦA VI KHUẨN Listeria, Salmonella spp., Staphylococcus aureus Ô NHIỄM TRONG THỊT LỢN Ở MỘT SỐ TỈNH PHÍA BẮC Chuyên... vi khuẩn Listeria, Salmonella spp S aureus thịt lợn tươi bán chợ Trung tâm số tỉnh phía Bắc 55 - Tỷ lệ nhiễm vi khuẩn Listeria, Salmonella spp., S aureus thịt lợn bán chợ Trung tâm số tỉnh phía. .. Kết tỷ lệ nhiễm Listeria nhiễm thịt lợn .75 3.2.2 Kết tỷ lệ nhiễm Salmonella spp nhiễm thịt lợn .76 3.2.3 Kết tỷ lệ nhiễm S aureus nhiễm thịt lợn 77 3.3 Xác định tiêu vi khuẩn
- Xem thêm -

Xem thêm: Nghiên cứu xác định tỷ lệ nhiễm và độc tố đường ruột (enterotoxin) của vi khuẩn Listeria, Salmonella spp., Staphylococcus aureus ô nhiễm trong thịt lợn ở một số tỉnh phía Bắc (LA tiến si), Nghiên cứu xác định tỷ lệ nhiễm và độc tố đường ruột (enterotoxin) của vi khuẩn Listeria, Salmonella spp., Staphylococcus aureus ô nhiễm trong thịt lợn ở một số tỉnh phía Bắc (LA tiến si), Nghiên cứu xác định tỷ lệ nhiễm và độc tố đường ruột (enterotoxin) của vi khuẩn Listeria, Salmonella spp., Staphylococcus aureus ô nhiễm trong thịt lợn ở một số tỉnh phía Bắc (LA tiến si)

Mục lục

Xem thêm

Gợi ý tài liệu liên quan cho bạn

Từ khóa liên quan

Nhận lời giải ngay chưa đến 10 phút Đăng bài tập ngay
Nạp tiền Tải lên
Đăng ký
Đăng nhập