Nghiên cứu và khuếch đại gene TK2017 mã hóa Osmotically Inducible Protein C ( OsmC) từ vi khuẩn chịu nhiệt Thermococcus kodakarensis KOD1.

63 16 0
  • Loading ...
1/63 trang

Thông tin tài liệu

Ngày đăng: 24/11/2016, 17:05

ĐẠI HỌC THÁI NGUYÊN TRƢỜNG ĐẠI HỌC NÔNG LÂM LÝ THỊ LƢỢNG Tên đề tài: NGHIÊN CỨU VÀ KHUẾCH ĐẠI GENE TK2017 MÃ HÓA OSMOTICALLY INDUCIBLE PROTEIN ( OsmC) TỪ VI KHUẨN CHỊU NHIỆT THERMOCOCCUS KODAKARENSIS KOD1 KHÓA LUẬN TỐT NGHIỆP ĐẠI HỌC Hệ đào tạo Chuyên ngành Khoa Khóa học : Chính quy : Công nghệ Sinh học : CNSH - CNTP : 2012 - 2016 Thái Nguyên, năm 2016 ĐẠI HỌC THÁI NGUYÊN TRƢỜNG ĐẠI HỌC NÔNG LÂM LÝ THỊ LƢỢNG Tên đề tài: NGHIÊN CỨU VÀ KHUẾCH ĐẠI GENE TK2017 MÃ HÓA OSMOTICALLY INDUCIBLE PROTEIN ( OsmC) TỪ VI KHUẨN CHỊU NHIỆT THERMOCOCCUS KODAKARENSIS KOD1 KHÓA LUẬN TỐT NGHIỆP ĐẠI HỌC Hệ đào tạo : Chính quy Chuyên ngành : Công nghệ Sinh học Khoa : CNSH - CNTP Lớp : K44 - CNSH Khóa học : 2012 - 2016 Giảng viên hƣớng dẫn: TS Phạm Bằng Phƣơng Thái Nguyên, năm 2016 i LỜI CẢM ƠN Trong trình học tập nghiên cứu để hoàn thành khóa luận tốt nghiệp nhận quan tâm, hướng dẫn, giúp đỡ tận tình thầy cô, bạn bè gia đình Nhân dịp hoàn thành luận văn này: Tôi xin chân thành gửi lời cảm ơn sâu sắc đến TS Phạm Bằng Phƣơng - giảng viên, trưởng môn Công nghệ Sinh học khoa Công nghệ Sinh học Công nghệ Thực phẩm ,Trường Đại học Nông Lâm Thái Nguyên hướng dẫn trực tiếp đề tài, thầy tận tình bảo tạo điều kiện thuận lợi để hoàn thành tốt đề tài Tôi xin cảm ơn kỹ sư Ma Thị Hoàn, Cán phòng trực thực hành Sinh học phân tử Kĩ thuật di truyền khoa Công nghệ Sinh học Công nghệ Thực phẩm, Trường Đại học Nông Lâm Thái Nguyên bạn sinh viên khoa Công nghệ Sinh học Công nghệ Thực phẩm làm nghiên cứu phòng Tôi xin chân thành cảm ơn Ban Chủ nghiệm Khoa Công nghệ Sinh học Công nghệ Thực phẩm, thầy cô khoa dạy dỗ suốt thời gian qua, cảm ơn cán công tác phòng thí nghiệm khoa Công nghệ Sinh học Công nghệ Thực phẩm tạo môi trường thuận lợi cho học tập, nghiên cứu, thực đề tài Cuối cùng, xin cảm ơn bố mẹ, thầy cô, bạn bè ủng hộ mặt vật chất tinh thần giúp hoàn thành đề tài Tôi xin chân thành cảm ơn ! Thái Nguyên, ngày 20 tháng 05 năm 2016 Sinh viên thực Lý Thị Lƣợng ii DANH MỤC CÁC BẢNG Bảng 2.1: Thành phần môi trường nuôi cấy phân lập vi khuẩn Thermococcus kodakarensis KOD1 Bảng 2.2 Thành phần khoáng chất vi lượng 12 Bảng 2.3 Thành phần Trace vitamins 13 Bảng 2.4 : Danh sách protein bị ảnh hưởng stress thẩm thấu T kodakarensis KOD1 22 Bảng 3.1: Cặp mồi sử dụng để nhân gene TK2017 29 Bảng 3.2: Thành phần phản ứng PCR 36 Bảng 4.1: Sự tương đồng chuỗi Peptid 41 iii DANH MỤC CÁC HÌNH Hình 2.1: Vi khuẩn Thermococcus kodakarensis KOD1 Hình 2.2: Cây phân loại vi khuẩn chịu nhiệt Thermococcus kodakarensis KOD1 Hình 2.3: Genome vi khuẩn chịu nhiệt Thermococcus kodakarensis KOD1 Hình 2.4 10 Hình 2.5 10 Hình 2.6 11 Hình 2.7 11 Hình 2.8 11 Hình 2.9 12 Hình 2.10: Phân tích hình ảnh sử dụng phần mền PDQuest 19 Hình 2.11: Xác định phiên beta chaperonin ( điểm 4) phép đo phổ khối 20 Hình 2.12: Phát protein up – redulated OsmC sốc căng thẳng T kodakarensis KOD1 phần mềm phân tích PDQuest 21 Hình 2.13: Những kiểu thể điểm protein T kodakarensis KOD1 stress thẩm thấu 25 Hình 3.1: Nhiệt độ gắn mồi cho phản ứng PCR gene TK2017 30 Hình 3.2 Điểm đẳng điện khối lượng phân tử protein OsmC 30 Hình 3.3: Sau bổ sung thành phần .32 Hình 3.4 Máy ly tâm 32 Hình 3.5: Sau ly tâm 33 Hình 3.6: Sau ly tâm lần 33 Hình 3.7: Chu trình nhiệt phản ứng PCR 37 Hình 4.1: Vùng bảo toàn sơ chức protein chứa gene TK2017 40 Hình 4.2.: So sánh trình tự peptid phần mềm Bioedit .41 iv Hình 4.3: Trình tự peptide OsmC/Ohr family stress-inducible protein [Thermococcus kodakarensis] 42 Hình 4.4: Trình tự peptide OsmC/Ohr family stress-inducible protein [Pyrococcus sp NA2] 42 Hình 4.5: Trình tự peptide OsmC/Ohr family stress-inducible protein [Thermococcus zilligii] 43 Hình 4.6: Trình tự peptide osmotically inducible protein OsmC [Thermococcus eurythermalis] 43 Hình 4.7: Kết tách chiết DNA genome từ vi khuẩn Thermococcus kodakarensis KOD1 44 Hình 4.8: Sản phẩm PCR gene TK2017 từ vi khuẩn Thermococcus kodakarensis KOD1 45 v DANH MỤC TỪ, CỤM TỪ VIẾT TẮT Từ viết tắt Nghĩa đầy đủ µl : Microlit (1 µl = 10-3 ml) DNA : Deoxyribonucleic acid - Một loại nucleic acid PCR : Polymerase Chain Reaction Bp : Base pair (Cặp base nito) dNTP : Deoxynucleotide Triphotphate Amp : Ampicillin BLAST : Basic Local Alignement Search Tool E coli : Escherichia coli IPTG : Isopropyl Thiogalactoside Kb : Kilo base -kilo base nito SDS : Sodium Dodecyl Sulfate TAE : Tris- acetate- EDTA NCBI : National center for biotechnology information Dal : Dalton TK : Thermococcus kodakarensis vi MỤC LỤC LỜI CẢM ƠN i DANH MỤC CÁC BẢNG ii DANH MỤC CÁC HÌNH iii DANH MỤC TỪ, CỤM TỪ VIẾT TẮT v MỤC LỤC vi Phần 1: MỞ ĐẦU 1.1 Đặt vấn đề 1.2 Mục đích nghiên cứu 1.3 Mục tiêu nghiên cứu 1.4 Ý nghĩa đề tài 1.4.1 Ý nghĩa khoa học 1.4.2 Ý nghĩa thực tiễn Phần 2: TỔNG QUAN TÀI LIỆU 2.1 Tổng quan vi khuẩn Thermococcus kodakarensis KOD1 2.1.1 Nguồn gốc phân loại 2.1.1.1 Nguồn gốc 2.1.1.2 Phân loại 2.1.2 Đặc điểm chung hệ gen 2.1.3 Vai trò vi khuẩn chịu nhiệt Thermococcus kodakarensis KOD1 2.1.4 Đặc điểm nuôi cấy 2.2 Tổng quan protein OsmC gene Tk2017 mã hóa 13 2.2.1 Protein 13 2.2.1.1.Khái niệm protein 13 2.2.1.2 Tính chất protein 13 2.2.1.3 Chức Protein 15 2.2.1.4 Vai trò protein 16 2.2.2 Protein OsmC gen Tk2017 mã hóa 18 2.2.2.1 Trình tự protein OsmC gene Tk2017 mã hóa 18 vii 2.2.2.2 Phân tích proteomic tác dụng thẩm thấu T.kodakarensis KOD1 19 2.3 Tình hình nghiên cứu nước giới 25 2.3.1 Tình hình nghiên cứu nước 25 2.3.2 Tình hình nghiên cứu giới 26 Phần 3: ĐỐI TƢỢNG, NỘI DUNG VÀ PHƢƠNG PHÁP NGHIÊN CỨU 28 3.1 Đối tượng phạm vi nghiên cứu 28 3.1.1 Đối tượng nghiên cứu 28 3.1.2 Phạm vi nghiên cứu 28 3.2 Địa điểm thời gian tiến hành 28 3.2.1 Địa điểm nghiên cứu 28 3.2.2 Thời gian tiến hành 28 3.3 Hóa chất, thiết bị vật liệu 28 3.3.1 Hóa chất 28 3.3.2 Thiết bị 29 3.3.3 Vật liệu 29 3.3 Nội dung nghiên cứu 31 3.4 Phương pháp nghiên cứu 31 3.4.1 Phương pháp nuôi phục hồi từ chủng gốc 31 3.4.2 Phương pháp tách triết DNA tổng số [10] 31 3.4.3 Phương pháp khuếch đại đoạn DNA phản ứng PCR 34 3.4.4 Phương pháp điện di gel Agarose[1] 37 Phần 4: KẾT QUẢ NGHIÊN CỨU 40 4.1 Kết so sánh trình tự protein gene TK2017 mã hóa với trình tự protein vi khuẩn công bố ngân hàng gene NCBI (Gene bank) 40 4.2 Kết tách triết DNA genome từ vi khuẩn Thermococcus kodakarensis KOD1 44 viii 4.3 Kết khuếch đại gene TK2017 từ hệ gene vi khuẩn Thermococcus kodakarensis KOD1 44 Phần 5: KẾT LUẬN VÀ KIẾN NGHỊ 46 5.1 Kết luận 46 5.2 Kiến nghị 46 TÀI LIỆU THAM KHẢO 39 Để nguội gel đến 60 o C đổ nhẹ nhàng vào khuôn tránh tạo bọt Để gel đông lại (20 - 30 phút), tháo lược, cho khuôn gel vào bể điện di Chạy điện di - Đổ đầy TAX X ngập khay điện di để gel ngập 0.1 cm - Cắt mảnh paraffin, hút - µl dung dịch đệm mẫu cho mẫu DNA - Hút µl dung dịch DNA trộn đều, tra vào giếng theo thứ tự sơ đồ điện di - Cắm điện cực cho dòng điện chạy từ (-) sang (+) - Bật nguồn cho chạy điện di vòng 30 - 35 phút - Nhuộm Ethidium bromide 0.01 % vòng 10 - 15 phút - Rửa gel cách ngâm nước - phút - Quan sát đèn tử ngoại chụp ảnh 40 Phần KẾT QUẢ NGHIÊN CỨU 4.1 Kết so sánh trình tự protein gene TK2017 mã hóa với trình tự protein vi khuẩn đƣợc công bố ngân hàng gene NCBI (Gene bank) Hình 4.1: Vùng bảo toàn sơ chức protein chứa gene TK2017 Để kiểm tra tương đồng protein gene Tk2017 mã hóa với trình tự protein vi khuẩn khác, tiến hành so sánh tương đồng protein giải trình tự với trình tự protein công bố ngân hàng gene giới (Gene bank) công cụ Bioedit thu kết sau: Kết so sánh cho thấy, trình tự chuỗi peptide protein giải trình tự có độ tương đồng cao với trình tự protein loại vi khuẩn ngân hàng NCBI Tỉ lệ tương đồng chuỗi peptid giải trình tự với trình tự peptid protein 1, protein 2, protein là: 41 protein Bảng 4.1: Sự tƣơng đồng chuỗi Peptid Max score Total score Query cover (%) Ident (%) Protein 285 285 100 100 Protein 266 266 97 95 Protein 234 234 99 80 Protein 208 208 97 77 (Kết cụ thể thể phụ lục 3) Hình 4.2.: So sánh trình tự peptid phần mềm Bioedit (Trình tự chuỗi peptid gene TK2017 mã hóa thể phụ lục 2) Ghi chú: Protein 1: OsmC/Ohr family stress-inducible protein [Thermococcus kodakarensis] (Trình tự peptid gene TK2017 giải trình tự) Protein 2: osmotically inducible protein OsmC [Thermococcus eurythermalis] (Trình tự peptid công bố từ gene bank) Protein 3: OsmC/Ohr family stress-inducible protein [Pyrococcus sp NA2] (Trình tự peptid công bố từ gene bank) Protein 4: OsmC/Ohr family stress-inducible protein [Thermococcus zilligii] (Trình tự peptid công bố từ gene bank) Từ hình ta thấy độ tương đồng chuỗi peptid sấp xỉ Điều chứng tỏ chuỗi peptid có chức gần tương tự 42 Có thể kết luận protein OsmC nằm chi Themococcus từ ta tiến hành phân lập khuếch đại gene TK2017 mã hóa protein OsmC từ vi khuẩn chịu nhiệt Thermococcus kodakarensis KOD1 So sánh trình tự peptid BLAST Hình 4.3: Trình tự peptide OsmC/Ohr family stress-inducible protein [Thermococcus kodakarensis] Hình 4.4: Trình tự peptide OsmC/Ohr family stress-inducible protein [Pyrococcus sp NA2] 43 Hình 4.5: Trình tự peptide OsmC/Ohr family stress-inducible protein [Thermococcus zilligii] Hình 4.6: Trình tự peptide osmotically inducible protein OsmC [Thermococcus eurythermalis] 44 4.2 Kết tách triết DNA genome từ vi khuẩn Thermococcus kodakarensis KOD1 Sau tách chiết cặn sinh khối vi khuẩn Thermococcus kodakarensis KOD1 tiến hành điện di kiểm tra sản phẩm tách triết DNA genome vi khuẩn Thermococcus kodakarensis KOD1 Kết thể hình 4.1 M Hình 4.7: Kết tách chiết DNA genome từ vi khuẩn Thermococcus kodakarensis KOD1 Ghi chú: M : Marker thang chuẩn : DNA tổng số vi khuẩn Thermococcus kodakarensis KOD1 Kết điện di kiểm tra sản phẩm tách chiết DNA tổng số hình 4.1 cho thấy băng DNA tổng số chạy rõ nét, gọn, không bị đứt gãy.Kết chứng tỏ DNA tổng số tách chiết từ mẫu có đủ điều kiện thực nghiên cứu 4.3 Kết khuếch đại gene TK2017 từ hệ gene vi khuẩn Thermococcus kodakarensis KOD1 Sau tách chiết thành công genome vi khuẩn Thermococcus kodakarensis KOD1 ta tiến hành chạy PCR để khuếch đại gene Tk2017 vi 45 khuẩn Thermococcus kodakarensis KOD1mã hóa choprotein OsmC Kết chạy PCR thể hình 4.2 Hình 4.8: Sản phẩm PCR gene TK2017 từ vi khuẩn Thermococcus kodakarensis KOD1 (Trình tự mạch đơn gene TK2017 thể phụ lục 1.) Ghi chú: M : Marker thang chuẩn : Sản phẩm PCR gene TK2017 từ vi khuẩn Thermococcus kodakarensis KOD1 Kết điện di cho thấy khuếch đại thành công đoạn gene với kích thước xấp xỉ khoảng đoạn gene TK2017 có chiều dài khoảng 420 bp Đây tiền để để tiến hành bước 46 Phần KẾT LUẬN VÀ KIẾN NGHỊ 5.1 Kết luận Đã xác định trình tự protein gene TK2017 mã hóa so sánh với protein vi khuẩn khác ngân hàng Genebank Đã tách chiết thành công DNA tổng số từ vi khuẩn Thermococcus kodakarensis KOD1 Đã khuếch đại thành công gene TK2017 phương pháp PCR từ vi khuẩn Thermococcus kodakarensis KOD1 5.2 Kiến nghị Do thời gian thực tập điều kiện phòng thí nghiệm có hạn nên dừng lại việc so sánh trình tự protein vi khuẩn Themococcus kodakarensis KOD1 với số trình tự protein khác ngân hàng liệu NCBI, nghiên cứu khuếch đại đoạn gen Tk2017 từ vi khuẩn Thermococcus kodakarensis KOD1, có thêm thời gian xin phép đưa số kiến nghị sau: 1.Tiếp tục thực nghiên cứu tạo dòng cho gen TK2017 tổng hợp Protein OsmC từ vi khuẩn chịu nhiệt Thermococcus kodakarensis KOD1 2.Tiến hành biểu gen TK2017 vào hệ thống biểu phù hợp Tinh kiểm tra hoạt tính protein biểu TÀI LIỆU THAM KHẢO I Tài liệu tiếng Anh 10 11 12 13 14 Fujiwara, S., M Takagi, and T Imanaka, Chaperonin from Thermococcus kodakaraensis KOD1 Methods Enzymol, 2001 334: p 293-301 Pham, B.P., et al., Architecture and characterization of a thermostable MoxR family AAA(+) ATPase from Thermococcus kodakarensis KOD1 Extremophiles, 2014 18(3): p 537-44 Pham, B.P., et al., Chaperone-Like Activity of a Bacterioferritin Comigratory Protein from Thermococcus kodakaraensis KOD1 Protein Pept Lett, 2015 22(5): p 443-8 Atomi, H., et al., Description of Thermococcus kodakaraensis sp nov., a well studied hyperthermophilic archaeon previously reported as Pyrococcus sp KOD1 Archaea, 2004 1(4): p 263-7 Fukui, T., et al., Complete genome sequence of the hyperthermophilic archaeon Thermococcus kodakaraensis KOD1 and comparison with Pyrococcus genomes Genome Res, 2005 15(3): p 352-63 Imanaka, T., T Fukui, and S Fujiwara, Chitinase from Thermococcus kodakaraensis KOD1 Methods Enzymol, 2001 330: p 319-29 Takagi, M., et al., Characterization of DNA polymerase from Pyrococcus sp strain KOD1 and its application to PCR Appl Environ Microbiol, 1997 63(11): p 450410 Akiba, T., et al., Structure of RadB recombinase from a hyperthermophilic archaeon, Thermococcus kodakaraensis KOD1: an implication for the formation of a near-7-fold helical assembly Nucleic Acids Res, 2005 33(10): p 3412-23 Ali, R and M.I Shafiq, Sequence, Structure, and Binding Analysis of Cyclodextrinase (TK1770) from T kodakarensis (KOD1) Using an In Silico Approach Archaea, 2015 2015: p 179196 Jongsareejit, B., et al., Gene cloning, sequencing and enzymatic properties of glutamate synthase from the hyperthermophilic archaeon Pyrococcus sp KOD1 Mol Gen Genet, 1997 254(6): p 635-42 Fujiwara, S., M Takagi, and T Imanaka, Archaeon Pyrococcus kodakaraensis KOD1: application and evolution Biotechnol Annu Rev, 1998 4: p 259-84 Takagi, M., Y Kai, and T Imanaka, Methylguanine methyltransferase from Thermococcus kodakaraensis KOD1 Methods Enzymol, 2001 334: p 239-48 Hong, S.J., et al., Cloning, expression, and characterization of thermophilic Lasparaginase from Thermococcus kodakarensis KOD1 J Basic Microbiol, 2014 54(6): p 500-8 Jeon, S.J., et al., Unique nucleoid structure during cell division of Thermococcus kodakaraensis KOD1 J Biosci Bioeng, 2001 91(1): p 40-3 II Tài liệu tiếng Việt 15 Lê Huy Chính (2007), Vi sinh vật Y học, Nxb Y học 16 Nguyễn Văn Cách (2005), Tin sinh học, Nxb Khoa học Công nghệ PHỤ LỤC 1: Trình tự mạch đơn gene TK2017 ATGAAGCGCCTTGAGTATTCAGCACACCTGAAGTGGGACGGCAAC GTCGGAAGTGAAGCGAAGGTGAGGG AGTTTACCTTTCACATAGACACGAACACGGACGGCCACAACAAAG GACCAAACCCGACGGAATACCTCTT GGCCGCTATAGGTGGCTGTCTGACTGTCAACTGGGGCAGGCTGAT CAAGAAGATGCGTCTCGACGTGAAG GGCTTTGAGGTAGAGGTCAGGGGCTGGCGCGGGCTTGACGAGCCC CAGCTGAAGGAGATAACCTACAAGA TCACCGTCTTCACTAACGAGGACGAGAAAAAGATTATGCGCGTTA AGGAGCTGGCCGAGAAGTACGGGAC GGTCTTCAACACCGTCGGGGCGGAGAAGATAAAGGGAGAAGTTGA GATAATAAAGCCGGCAGATCCGTGA Tk2017 420 base pairs Graphic map | Table by enzyme name Bsp143II BstH2I Eco57I DrdI atgaagcgccttgagtattcagcacacctgaagtgggacggcaacgtcggaagtgaagcgaaggtgaggga gttt base pairs tacttcgcggaactcataagtcgtgtggacttcaccctgccgttgcagccttcacttcgcttccactccctcaaa to 75 HaeII CfrI CfrI BstSFI acctttcacatagacacgaacacggacggccacaacaaaggaccaaacccgacggaatacctcttggccgct ata base pairs tggaaagtgtatctgtgcttgtgcctgccggtgttgtttcctggtttgggctgccttatggagaaccggcgatat 76 to 150 EaeI EaeI SfcI Ksp22I HindII FbaI Esp3I ggtggctgtctgactgtcaactggggcaggctgatcaagaagatgcgtctcgacgtgaagggctttgaggtag ag base pairs ccaccgacagactgacagttgaccccgtccgactagttcttctacgcagagctgcacttcccgaaactccatctc 151 to 225 HincII BclI BsmBI PvuII FriOI BbsI AlwNI BanII Eco57I Bbv16II gtcaggggctggcgcgggcttgacgagccccagctgaaggagataacctacaagatcaccgtcttcactaac gag base pairs cagtccccgaccgcgcccgaactgctcggggtcgacttcctctattggatgttctagtggcagaagtgattgctc 226 to 300 Eco24I BpuAI NspBII BpiI MspA1I BbsI CfrI Bbv16II gacgagaaaaagattatgcgcgttaaggagctggccgagaagtacgggacggtcttcaacaccgtcggggc ggag base pairs ctgctctttttctaatacgcgcaattcctcgaccggctcttcatgccctgccagaagttgtggcagccccgcctc 301 to 375 EaeI BpuAI BpiI NgoAIV MflI NgoMI BstX2I BsrFI Cfr10I aagataaagggagaagttgagataataaagccggcagatccgtga base pairs ttctatttccctcttcaactctattatttcggccgtctaggcact 376 to 420 BssAI NaeI Bse118I BstYI MroNI XhoII PHỤ LỤC 2: Trình tự protein đƣợc mã hóa gene TK 2017 MKRLEYSAHLKWDGNVGSEAKVREFTFHIDTNTDGHNKGPNPTEYL LAAIGGCLTVNWGRLIKKMRLDVK GFEVEVRGWRGLDEPQLKEITYKITVFTNEDEKKIMRVKELAEKYGT VFNTVGAEKIKGEVEIIKPADP PHỤ LỤC Sự tƣơng đồng trình tự peptid XÁC NHẬN ĐÃ SỬA CHỮA THEO GÓP Ý CỦA HỘI ĐỒNG Ngƣời nhận xét phản biện Thái nguyên, ngày … tháng … năm 2016 Ngƣời hƣớng dẫn [...]... cysteines bảo tồn đư c nhận dạng với c u tr c b c 2 Từ những nhận định trên tôi tiến hành th c hiện đề tài: Nghiên c u và khuếch đại gene TK2017 mã hóa Osmotically Inducible Protein C ( OsmC) từ vi khuẩn chịu nhiệt Thermococcus kodakarensis KOD1” Để nắm bắt và tìm hiểu sâu hơn về vấn đề này 1.2 M c đích nghiên c u Nghiên c u và khuếch đại đư c gene TK2017 mã hóa Osmotically Inducible Protein C ( OsmC). .. OsmC) từ vi khuẩn chịu nhiệt Thermococcus kodakarensis KOD1 1.3 M c tiêu nghiên c u - Nghiên c u đ c điểm protein OsmC do gen Tk2017 mã hóa - Khuếch đại đư c gene Tk2017 mã hóa Protein OsmC từ vi khuẩn chịu nhiệt Thermococcus kodakarensis KOD1 bằng phương pháp PCR 3 1.4 Ý nghĩa c a đề tài 1.4.1 Ý nghĩa khoa h c Kết quả c a đề tài là c sở cho c c nghiên c u kế tiếp c liên quan đến gene TK2017 mã hóa. .. sự chú ý c a c c nhà nghiên c u trong lĩnh v c kỹ thuật di truyền[2] Hình 2.1: Vi khuẩn Thermococcus kodakarensis KOD1 5 2.1.1.2 Phân loại Hình 2.2: C y phân loại vi khuẩn chịu nhiệt Thermococcus kodakarensis KOD1 Vi khuẩn Thermococcus kodakarensis KOD1 đư c phân loại như sau: Giới: Archaea Ngành: Euyarchaeota Lớp: Thermococci Bộ: Thermococcales Họ: Thermococcaceae Chi: Thermococcus Loài: Thermococus... genome c a vi khuẩn Thermococcus kodakarensis KOD1, c a vi n nghiên c u hóa sinh tổng hợp, Trường Đại H c Kyoto, thu c Katsura, Nashikyo- ku, Nhật Bản, tháng 3 năm 2005[5] Nghiên c u đã chỉ ra rằng c c chi Thermococcus, bao gồm c c vi khuẩn c Hyperthermophilic, c c thành vi n c a Thermococcus c mặt ở khắp nơi trong môi trường nhiệt độ cao, và đóng một vai trò quan trọng trong hệ sinh thái và trao đổi chất... c u trong nư c Trên thế giới đã c rất nhiều c ng trình nghiên c u về vi khuẩn chịu nhiệt Thermococcus kodarensis KOD1do đ c tính đ c biệt là nó c thể sống trong môi trường c nhiệt độ kh c nhiệt Tuy nhiên, ở Vi t Nam chưa thấy c một bài vi t nào nghiên c u về loài vi khuẩn này 26 2.3.2 Tình hình nghiên c u trên thế giới Trên thế giới c rất nhiều nghiên c u về Thermococcus, như nghiên c u hoàn thiện... TK2017 mã hóa protein ( OsmC) từ vi khuẩn chịu nhiệt Thermococcus kodakarensis KOD1 1.4.2 Ý nghĩa trong th c tiễn Sản phẩm c a nghiên c u mở ra hướng nghiên c u ứng dụng tạo dòng gene, biểu hiện protein, tinh sạch và kiểm tra hoạt tính c a nó 4 Phần 2 TỔNG QUAN TÀI LIỆU 2.1 Tổng quan về vi khuẩn Thermococcus kodakarensis KOD1 2.1.1 Nguồn g c và phân loại 2.1.1.1 Nguồn g c Vi khuẩn Thermococcus kodakarensis. .. hệ vi sinh vật hoạt động trong hệ sinh thái nư c nóng Fukui T và cs đã x c định và ghi chú c c bộ gen 2.088.737 -c sở hoàn chỉnh c a Thermococcus kodakaraensis KOD1, theo sau là sự so sánh với ba bộ gen hoàn chỉnh c a Pyrococcus spp Tổng c ng c 2306 trình tự DNA mã hóa (CDS) đã đư c x c định, trong đó một nửa (1 165 CDS) là chú thích, trong khi c c ch c năng c a 41% (9 36 CDS) không thể đư c dự đoán từ. .. tích bằng kính hiển vi điện tử Thermococcus kodakarensis c hoạt tính peroxidase quan trọng hướng tới c peroxit hữa c và vô c chỉ ở nhiệt độ cao Thermococcus kodakarensis c 2 bảo tồn Cystein Cys112 c lien quan đến hoạt động c a peroxidase và thu hồi disulfide C c Cystein Cys25 kh c cơ thể lien quan đến sự ổn định c a c u tr c thứ c p 2.2.2.1 Trình tự proteinOsmC do gene Tk2017 mã hóa MKRLEYSAHLKWDGNVGSEAKVREFTFHIDTNTDGHNKGPN... trong khi c c protein c u c nhiều nếp gấp β hơn C u tr c b c ba: C c xoắn α và phiến gấp nếp β c thể cuộn lại với nhau thành từng búi c hình dạng lập thể đ c trưng cho từng loại protein C u tr c không gian này c vai trò quyết định đối với hoạt tính và ch c năng c a protein C u tr c này lại đ c biệt phụ thu c vào tính chất c a nhóm -R trong c c mạch polypeptide Chẳng hạn nhóm -R c a cysteine c khả... vụ c a c c protein kh c như tham gia vào quá trình chuyển hóa pyruvate, chuyển hóa nucleotide, vận chuyển kim loại ion Gần đây nhất là nghiên c u c a c c nhà khoa h c thu c phòng thí nghiệm vi sinh, trường đại h c Wageningen, Phần Lan vào tháng 7 năm 2015 với nội dung trình bày về số lượng nhiễm s c thể c a Thermococcus kodakarensis KOD1, c c nhà khoa h c đã nghiên c u và đưa ra nhận định rằng c c euryarchaeon
- Xem thêm -

Xem thêm: Nghiên cứu và khuếch đại gene TK2017 mã hóa Osmotically Inducible Protein C ( OsmC) từ vi khuẩn chịu nhiệt Thermococcus kodakarensis KOD1., Nghiên cứu và khuếch đại gene TK2017 mã hóa Osmotically Inducible Protein C ( OsmC) từ vi khuẩn chịu nhiệt Thermococcus kodakarensis KOD1., Nghiên cứu và khuếch đại gene TK2017 mã hóa Osmotically Inducible Protein C ( OsmC) từ vi khuẩn chịu nhiệt Thermococcus kodakarensis KOD1.

Gợi ý tài liệu liên quan cho bạn

Nạp tiền Tải lên
Đăng ký
Đăng nhập