Nghiên cứu và khuyếch đại gene Tk 1284 mã hóa enzyme peptidase của vi khuẩn chịu nhiệt Thermonococcus kodakarensis KOD1

57 12 0
  • Loading ...
1/57 trang

Thông tin tài liệu

Ngày đăng: 24/11/2016, 17:02

ĐẠI HỌC THÁI NGUYÊN TRƢỜNG ĐẠI HỌC NÔNG LÂM LÊ THỊ TRÀ MI Tên đề tài: “NGHIÊN CỨU VÀ KHUYẾCH ĐẠI GENE TK 1284 MÃ HÓA ENZYME AMINOPEPTIDASE TỪ VI KHUẨN CHỊU NHIỆT THERMOCOCCUS KODAKARENSIS KOD1” KHÓA LUẬN TỐT NGHIỆP ĐẠI HỌC Hệ đào tạo Chuyên ngành Khoa Khóa học : Chính quy : Công nghệ Sinh học : CNSH - CNTP : 2012 - 2016 Thái Nguyên, năm 2016 ĐẠI HỌC THÁI NGUYÊN TRƢỜNG ĐẠI HỌC NÔNG LÂM LÊ THỊ TRÀ MI Tên đề tài: “NGHIÊN CỨU VÀ KHUYẾCH GENE TK 1284 MÃ HÓA ENZYME AMINOPEPTIDASE TỪ VI KHUẨN CHỊU NHIỆT THERMOCOCCUS KODAKARENSIS KOD1” KHÓA LUẬN TỐT NGHIỆP ĐẠI HỌC Hệ đào tạo : Chính quy Chuyên ngành: Công nghệ Sinh học Khoa : CNSH - CNTP Lớp : K44 - CNSH Khóa học : 2012 - 2016 Giảng viên hƣớng dẫn: TS Phạm Bằng Phƣơng Thái Nguyên, năm 2016 i LỜI CẢM ƠN Đƣợc đồng ý khoa Khoa Công Nghệ Sinh Học Công Nghệ Thực Phẩm, Trƣờng Đại Học Nông Lâm Thái Nguyên Em thực tập tốt nghiệp Phòng Nuôi Cấy Mô Tế Bào Thực Vật - Khoa Công Nghệ Sinh Học Công Nghệ Thực Phẩm- Trƣờng Đại Học Nông Lâm Thái Nguyên với đề tài: “Nghiên cứu khuyếch đại gene Tk 1284 mã hóa enzyme peptidase vi khuẩn chịu nhiệt Thermonococcus kodakarensis KOD1” Để hoàn thành khóa luận tốt nghiệp nỗ lực thân em nhận đƣợc nhiều giúp đỡ ban giám hiệu Nhà trƣờng Đại Học Nông Lâm Thái Nguyên, Ban chủ nhiệm khoa Công Nghệ sinh học công nghệ thực phẩm, tận tình giảng dạy thầy cô suốt năm học Với lòng biết ơn sâu sắc em xin chân thành cảm ơn Ban giám hiệu, Ban chủ nhiệm khoa toàn thể thầy cô giáo Đặc biệt, em xin đƣợc bày tỏ lòng kính trọng, lòng biết ơn tới thầy giáo TS Phạm Bằng Phƣơng ngƣời tận tình hƣớng dẫn em suốt trình em thực đề tài Em xin cảm ơn chị Ma Thị Hoàn, cán phòng thí nghiệm Công nghệ tế bào thực vật khoa Công Nghệ Sinh Học công nghệ thực phẩm, Trƣờng Đại HọcNông Lâm Thái Nguyên tạo điều kiện giúp đỡ em trình thực đề tài khóa luận tốt nghiệp Em xin gửi lời biết ơn đến gia đình, ngƣời thân bạn bè động viên giúp đỡ em suốt thời gian qua Do điều kiện thời gian có hạn nên tránh khỏi thiếu sót, kính mong thầy cô đóng góp ý kiến xây dựng để đề tài em đƣợc hoàn thiện Em xin chân thành cảm ơn ! Thái Nguyên, ngày tháng năm 2016 Sinh viên thực Lê Thị Trà Mi ii DANH MỤC CÁC BẢNG Trang Bảng 3.1: Thành phần môi trƣờng 18 Bảng 3.2: Trình tự mồi 18 Bảng 3.3: Thành phần phản ứng PCR 27 Bảng 3.4: Chu trình nhiệt PCR 27 Bảng 4.1: Dải nhiệt độ chạy PCR 35 iii DANH MỤC CÁC HÌNH Trang Hình 2.1: Nơi phân lập Hình 2.2: Vi khuẩn T Kodakarensis kod1 Hình 2.3: Cây phân loại nhóm vi khuẩn Thermococcus Hình 2.4: Sơ đồ giải trình tự gen vi khuẩn Thermococcus kodakarensis KOD1 Hình 2.5: Enzyme protease 10 Hình 2.6: Cấu trúc enzyme 11 Hình 2.7: Sơ đồ phân loại enzyme protease 12 Hình 3.1: Môi trƣờng nuôi cấy phân lập VK 23 Hình 3.2: Phân tử Ethidium bromide 25 Hình 4.1a: Môi trƣờng nuôi cấy vi khuẩn T Kodakarensis 31 Hình 4.1b: Ảnh điện di sản phẩm tách chiết ADN tổng số 32 Hình 4.2a: Thiết kế mồi 32 Hình ảnh 4.2b: Kết điện di sản phẩm PCR 33 Hình 4.3: Ảnh điện di kiểm tra nhiệt độ gắn mồi PCR 34 : iv DANH MỤC CÁC TỪ, CỤM TỪ VIẾT TẮT DNA :Axit deoxiribonucleic ARN : Axit ribonucleic ARNase : Ribonuclease dNTP : Deoxynucleoside triphosphate EDTA : Ethylene diamine tetra – acetic acid OD : Optical Density (Mật độ quang học) PCR : polymerase chain reaction SDS : Sodium Dodecyl Sulphate TAE : Tris- acetate- EDTA E.coli : Escherichia coli Amp : Ampicillin EtBr : Ethydium bromide Bp : base pair Kb : kilo base pair v MỤC LỤC Trang LỜI CẢM ƠN i DANH MỤC CÁC BẢNG ii DANH MỤC CÁC HÌNH iii DANH MỤC CÁC TỪ, CỤM TỪ VIẾT TẮT iv MỤC LỤC v PHẦN I: MỞ ĐẦU 1.1 Đặt vấn đề 1.2 Mục đích nội dung đề tài 1.2.1 Mục đích 1.2.2 Nội dung 1.3 Ý nghĩa đề tài 1.3.1 Ý nghĩa khoa học 1.3.2 Ý nghĩa thực tiễn PHẦN II: TỔNG QUAN TÀI LIỆU 2.1 Tổng quan vi khuẩn Thermococcus kodakarensis KOD1 2.1.1 Nguồn gốc 2.1.2 Phân loại 2.1.3 Đặc điểm chung hệ gen 2.1.4 Đặc điểm sinh trƣởng phát triển 2.2 Tổng quan protein TK 1284 2.2.1 Enzyme proteae 2.2.2 Hệ thống phân loại enzyme protease 12 2.2.3 Ứng dụng 13 2.2.4 Aminopeptidase gene Tk1284 vi khuẩn T Kodakarensi KOD1 mã hóa 15 vi 2.3 Tình hình nghiên cứu nƣớc giới 15 PHẦN 3: Đối tƣợng , nội dung phƣơng pháp nghiên cứu 17 3.1 Đối tƣợng nghiên cứu 17 3.2.Nội dung 17 3.4 Địa điểm thời gian tiến hành 18 3.5 Thiết bị 18 3.6 Phƣơng pháp nghiên cứu 19 3.5.1.phƣơng pháp so sánh trình tự protein……………………………21 3.5.2 Phƣơng pháp nuôi cấy 24 3.5.3 Phƣơng pháp tách chiết AND tổng số 234 3.5.5 Phƣơng pháp PCR 26 3.5.4 Phýõng pháp ðiện di 24 PHẦN IV: KẾT QUẢ VÀ THẢO LUẬN 28 4.3 Kết kiểm tra nhiệt độ mồi ảnh hƣởng đên phản ứng PCR 34 4.1 Kết tách chiết ADN tổng số 31 4.2 Nhân gene TK 1284 từ chủng vi khuẩn Thermococcus kodakaren KOD1 phản ứng PCR 32 4.4 Kết so sánh trình tự TK 1284 với protein biết ngân hàng NCBI phần mềm Runblast bioedit 28 PHẦN V: KẾT LUẬN VÀ KIẾN NGHỊ 35 5.1 Kết luận 36 5.2 Kiến nghị 36 TÀI LIỆU THAM KHẢO I Tài liệu tiếng Việt II Tài liệu tiếng Anh PHỤ LỤC PHẦN I: MỞ ĐẦU 1.1 Đặt vấn đề Ngày nay, với phát triển mạnh mẽ Công nghệ sinh học, chế phẩm enzyme đƣợc sản xuất nhiều đƣợc sử dụng hầu hết lĩnh vực nhƣ: chế biến thực phẩm, nông nghiệp, chăn nuôi, y tế…[1] Hàng năm lƣợng enzyme đƣợc sản xuất giới đạt khoảng 300 nghìn với giá trị 500 triệu USD, đƣợc phân phối ngành khác nhau[1] Phần lớn enzyme đƣợc sản xuất quy mô công nghiệp thuộc loại enzyme đơn cấu tử, xúc tác cho phản ứng phân hủy[2] Khoảng 75% chế phẩm enzyme thủy phân, đƣợc sử dụng cho việc thủy phân chất tự nhiên Ngành sản xuất hóa chất công nghiệp dựa xúc tác sinh học cho thấy có nhiều lợi so với tổng hợp hóa học, ví dụ nhƣ sản xu ất có chọn lọc đồng phân quang học sử dụng sinh khối, hỗn hợp phức tạp phân tử hữu cơ, làm nguyên liệu[3] Việc sử dụng enzyme chịu nhiệt nhƣ chất xúc tác thiết kế quy trình chuyển hóa, chứa toàn hệ thống enzyme chịu nhiệt, cấu tạo nên chuổi phản ứng mà muốn, làm biến tính enzyme nội sinh tế bào cần bƣớc chuẩn bị để có hỗn hợp enzyme chịu nhiệt Thêm vào đó, đặc tính bền enzyme chịu nhiệt nên hạn chế bất lợi sinh chuyển hóa in vitro, khả tổng hợp tái tạo protein Protease enzyme đƣợc sử dụng nhiều số ngành sản xuất nhƣ: chế biến thực phẩm (làm đông tụ sữa làm mát, làm mềm thịt, bổ sung để làm tăng chất lƣợng sản phẩm sản xuất bia, xử lý phế phụ phẩm chế biến thực phẩm…), sản xuất chất tẩy rửa, thuộc da, y tế Qua nhiều năm, việc gia tăng sử dụng vi sinh vật nhƣ nguồn cung cấp protease cải thiện đáng kể hiệu sản xuất sản phẩm đƣợc tạo nhiều Tuy nhiên giá thành chế phẩm protease cao, hạn chế việc sử dụng rộng rãi enzyme sản xuất Protease phân bố thực vật, động vật, vi sinh vật Tuy nhiên nguồn enzyme chế phẩm thu đƣợc sau trình nuôi cấy sản xuất enzyme chƣa phải chế phẩm có độ tinh khiết cao protein chiếm từ 20-30 %[1] Protease động vật hay thực vật chứa hai loại endopeptidase exopeptidase, riêng vi khuẩn có khả sinh hai loại trên, protease vi khuẩn có tính đặc hiệu chất cao Chúng có khả phân hủy tới 80% liên kết peptide phân tử protein Đặc biệt vi khuẩn cổ sống môi trƣờng khắc nghiệt, có tính chống chịu với nhiệt hay axít kiềm, nguồn tạo enzyme hoạt động dƣới điều kiện khắc nghiệt Những enzyme phát đƣợc tạo từ vi khuẩn có khả chịu nhiệt 130˚C, tồn phát triển nơi có nồng độ acid cao… [1]với khả nhƣ có ý nghĩa nghiên cứu khoa học, cho phát triển ngành sản xuất Chính vậy, việc nghiên cứu tạo enzyme từ vi khuẩn cấp thiết, đáp ứng nhu cầu sử dụng enzyme protease nghiên cứu nói chung công nghiệp xuất nói riêng quan trọng cấp thiết, xuất phát từ lý trên, xin tiến hành đề tài: “Nghiên cứu khuyếch đại gene Tk 1284 mã hóa enzyme peptidase từ vi khuẩn chịu nhiệt Thermococcus kodakarensis KOD1” hy vọng khuyếch đại đƣợc dòng gene Tk 1284 mã hóa enzyme aminopeptidase vi khuẩn T Kodakarensis đáp ứng nhu cầu cần thiết 1.2 Mục đích nội dung đề tài 1.2.1 Mục đích  Nghiên cứu gene Tk 1284 enzyme peptidase gen Tk 1284 vi khuẩn Thermococcus kodakarensis KOD1 mã hóa  Nhân nhanh gene Tk1284 vi khuẩn Thermococcus kodakarensis KOD1 phản ứng PCR 35 Bảng 4.1: Dải nhiệt độ chạy PCR Tm 55 55,99 58,63 59,84 61,27 62,48 64,13 65,23 65,89 66 Mẫu 10 Kết điện di agarose 1,5% cho thấy chạy PCR với thành phần PCR giống hệt ,khác nhiệt độ gắn mồi, dải nhiệt độ từ 55- 66˚C không ảnh hƣởng đên kết PCR, tất nhiệt độ nằn khoảng cho kết nhƣ nhau, nhiệt độ tối ƣu mồi để chạy phản ứng PCR gene TK 1284 vi khuẩn Thermococcus kodakarensis kod1 với cặp mồi đặc hiệu từ 55- 66˚C 36 PHẦN V: KẾT LUẬN VÀ KIẾN NGHỊ 5.1 Kết luận Từ kết nghiên cứu đề tài đến kết luận nhƣ sau: + Đã xác định đƣợc vùng domain bảo toàn Tk1284 có chức ATP-independent intracellular protease phân giải peptide nhỏ +Đã nhân đƣợc gene Tk 1284 vi khuẩn Thermococcus kodakarensis KOD1 với kích thƣớc 500 bp 5.2 Kiến nghị Do điều kiện thời gian có hạn nên dừng lại nghiên cứu khuyếch đại gene Tk1284 vi khuẩn Thermococcus kodakarensis KOD1 kỹ thuật PCR đề nghị nghiên cứu sau tiếp tục: + Tạo vector tạo dòng pGEM T easy – Tk1284 vector biểu pET 28a – Tk1284 + Biểu protein Tk1284 + Tinh sạch, kiểm tra hoạt tính ATP-independent intracellulase protease TÀI LIỆU THAM KHẢO I Tài liệu tiếng Việt PGS TS PHAN TUẤN NGHĨA , GS TSKH PHẠM THỊ TRÂN CHÂU(2008) , Enzyme Và Ứng Dụng Khoa học kỹ thuật, tập3, NXB Giáo dục 196 Quyền Đình Thi and Nông Văn Hải(2008), Những Kỹ Thuật PCR Và Ứng Dụng Trong Phân Tích DNA, tập 2, NXB Khoa Học Tự Nhiên Và Công Nghệ 120 PGS.TS Lê Gia Hy (Chủ biên) PGS TS Khuất Hữu Thanh(2010), Cơ Sở Công Nghệ Vi Sinh Vật Và Ứng Dụng Giáo trình Cao đẳng - Đại Học., NXB Giáo dục 384 PGS TSLê Ngọc Tú( 1977), Hóa sinh công nghiệp,NXB Đại Học THCN, Hà Nội 280 Trần Thị Thanh(2007), công nghệ vi sinh, tập 1.,NXB Đại học Quốc gia TP.HCM 48 GS.TS LÊ ĐÌNH LƢƠNG(2001) , Nguyên Lý Kỹ Thuật di Truyền,NXB Khoa học kỹ thuật NXB: Khoa học kỹ thuật Nguyễn Đức Lƣơng, công nghệ vi sinh(2000).,Tập2, , NXB Đại học Quốc gia TP.HCM 57 II Tài liệu tiếng Anh Matsumura, H., et al., Crystal structure of intein homing endonuclease II encoded in DNA polymerase gene from hyperthermophilic archaeon Thermococcus kodakaraensis strain KOD1 Proteins, 2006 63(3): p 711-5 Koga, Y., et al., Proteolysis of abnormal prion protein with a thermostable protease from Thermococcus kodakarensis KOD1 Appl Microbiol Biotechnol, 2014 98(5): p 2113-20 10 Jeon, S.J., et al., Tk-PTP, protein tyrosine/serine phosphatase from hyperthermophilic archaeon Thermococcus kodakaraensis KOD1: enzymatic characteristics and identification of its substrate proteins Biochem Biophys Res Commun, 2002 295(2): p 508-14 11 Imanaka, T., T Fukui, and S Fujiwara, Chitinase from Thermococcus kodakaraensis KOD1 Methods Enzymol, 2001 330: p 319-29 12 Higashibata, H., et al., Analysis of DNA compaction profile and intracellular contents of archaeal histones from Pyrococcus kodakaraensis KOD1 Biochem Biophys Res Commun, 1999 258(2): p 416-24 13 14 15 16 17 18 19 20 21 22 23 24 25 Hong, S.J., et al., Cloning, expression, and characterization of thermophilic L-asparaginase from Thermococcus kodakarensis KOD1 J Basic Microbiol, 2014 54(6): p 500-8 Hashimoto, H., et al., Crystal structure of DNA polymerase from hyperthermophilic archaeon Pyrococcus kodakaraensis KOD1 J Mol Biol, 2001 306(3): p 469-77 Hashimoto, H., et al., Crystallographic studies on a family B DNA polymerase from hyperthermophilic archaeon Pyrococcus kodakaraensis strain KOD1 J Biochem, 1999 125(6): p 983-6 Han, T., et al., Biochemical characterization of a recombinant pullulanase from Thermococcus kodakarensis KOD1 Lett Appl Microbiol, 2013 57(4): p 336-43 Hanazono, Y., et al., Crystal structures of chitin binding domains of chitinase from Thermococcus kodakarensis KOD1 FEBS Lett, 2016 590(2): p 298-304 Fukui, T., et al., Complete genome sequence of the hyperthermophilic archaeon Thermococcus kodakaraensis KOD1 and comparison with Pyrococcus genomes Genome Res, 2005 15(3): p 352-63 Fukuda, W., et al., Characterization of an archaeal malic enzyme from the hyperthermophilic archaeon Thermococcus kodakaraensis KOD1 Archaea, 2005 1(5): p 293-301 Fukuda, W., et al., First characterization of an archaeal GTPdependent phosphoenolpyruvate carboxykinase from the hyperthermophilic archaeon Thermococcus kodakaraensis KOD1 J Bacteriol, 2004 186(14): p 4620-7 Fujiwara, S., M Takagi, and T Imanaka, Archaeon Pyrococcus kodakaraensis KOD1: application and evolution Biotechnol Annu Rev, 1998 4: p 259-84 Fujiwara, S., M Takagi, and T Imanaka, Chaperonin from Thermococcus kodakaraensis KOD1 Methods Enzymol, 2001 334: p 293-301 Fujiwara, S., et al., Unusual enzyme characteristics of aspartyl-tRNA synthetase from hyperthermophilic archaeon Pyrococcus sp KOD1 FEBS Lett, 1996 394(1): p 66-70 Ezaki, S., et al., Gene analysis and enzymatic properties of thermostable beta-glycosidase from Pyrococcus kodakaraensis KOD1 J Biosci Bioeng, 1999 88(2): p 130-5 Ezaki, S., et al., Presence of a structurally novel type ribulosebisphosphate carboxylase/oxygenase in the hyperthermophilic 26 27 28 29 30 31 32 archaeon, Pyrococcus kodakaraensis KOD1 J Biol Chem, 1999 274(8): p 5078-82 Rahman, R.N., et al., Sequence analysis of glutamate dehydrogenase (GDH) from the hyperthermophilic archaeon Pyrococcus sp KOD1 and comparison of the enzymatic characteristics of native and recombinant GDHs Mol Gen Genet, 1998 257(3): p 338-47 Sun, Y., et al., Recombinant cyclodextrinase from Thermococcus kodakarensis KOD1: expression, purification, and enzymatic characterization Archaea, 2015 2015: p 397924 Morikawa, M and T Imanaka, Thiol protease from Thermococcus kodakaraensis KOD1 Methods Enzymol, 2001 330: p 424-33 Takagi, M., Y Kai, and T Imanaka, Methylguanine methyltransferase from Thermococcus kodakaraensis KOD1 Methods Enzymol, 2001 334: p 239-48 Pham, B.P., et al., Architecture and characterization of a thermostable MoxR family AAA(+) ATPase from Thermococcus kodakarensis KOD1 Extremophiles, 2014 18(3): p 537-44 Nagahisa, K., et al., Sequence and transcriptional studies of five clustered flagellin genes from hyperthermophilic archaeon Pyrococcus kodakaraensis KOD1 FEMS Microbiol Lett, 1999 178(1): p 183-90 Pham, B.P., et al., Chaperone-Like Activity of a Bacterioferritin Comigratory Protein from Thermococcus kodakaraensis KOD1 Protein Pept Lett, 2015 22(5): p 443-8 PHỤ LỤC Tình tự gene TK 1284 BbsI Bbv16II atgaaggtcttgattctgagtgctgacggttttgaagaccttgagctgatatatcctctccacaggatcaagg aa base pairs tacttccagaactaagactcacgactgccaaaacttctggaactcgactatataggagaggtgtcctagttcc tt to 75 BpuAI BpiI EarI Psp14 Eam1104IHindII gagggccatgaagtctatgtcgccagcttccagaggggcaagataacgggcaagcacggctacacggtcaacg tt base pairs ctcccggtacttcagatacagcggtcgaaggtctccccgttctattgcccgttcgtgccgatgtgccagttgc aa 76 to 150 Ksp632I HincII HincII BsaWIBsaWI 06IBseAI Kpn2IAccB1I MroI AccIII GsuI Eco64I gaccttgcctttgacgaggttgatccggacgagttcgacgcgctggttctccctggaggaagggcaccggaga tc base pairs ctggaacggaaactgctccaactaggcctgctcaagctgcgcgaccaagagggacctccttcccgtggcctct ag 151 to 225 Bsp13IBpmI BanI HindII BsiMI BshNI BspEI Bsp68IAsp700I gtcaggctgaacgaaaaggccgtcgcgataacgaagaagatgttcgaggacggaaagccagttgcaagcatct gc base pairs cagtccgacttgcttttccggcagcgctattgcttcttctacaagctcctgcctttcggtcaacgttcgtaga cg 226 to 300 NruIXmnI BsaBI Bse118IBsiHKAI MamIBssAI NaeI Alw21I BstEII DsaI BsrBRI SgrAI MroNIBsiI PspEI cacgggccgcagatactcatctccgccggcgtgttgaagggaaggaagggcacgagcacggtaaccatcaggg ac base pairs gtgcccggcgtctatgagtagaggcggccgcacaacttcccttccttcccgtgctcgtgccattggtagtccc tg 301 to 375 BstDSI Bsh1365I BsrFI Cfr10I BssSI EcoO65I Bse8I NgoMIBbv12I Eco91I NgoAIV AspHI BstPI BshNI AcyI BstH2I BanI NarI EheIAccB1I KasI Msp17I HaeII DrdIHindII Eco64I gacgtgaagaacgctggcgccgagtggattgacgcggaggtcgtcgttgacggaaactgggtcagttcaaggc ac base pairs ctgcacttcttgcgaccgcggctcacctaactgcgcctccagcagcaactgcctttgacccagtcaagttccg tg 376 to 450 Eco64I Hsp92I HincII BanI AccB1I BbiII BbeI BshNI Hin1I BsaHI Bsp143II PpuMI DraIIHindIII ccaggggacctgtacgcctggatgagagagttcgtcaagcttcttaggtga base pairs ggtcccctggacatgcggacctactctctcaagcagttcgaagaatccact 451 to 501 EcoO109I Psp5II Trình tự protein: >gi|499569452|ref|WP_011250235.1| glutamine amidotransferase [Thermococcus kodakarensis] MKVLILSADGFEDLELIYPLHRIKEEGHEVYVASFQRGKITGKHGYTVNVDLAFDEVDPDEFDALVLPGG RAPEIVRLNEKAVAITKKMFEDGKPVASICHGPQILISAGVLKGRKGTSTVTIRDDVKNAGAEWIDAEVV VDGNWVSSRHPGDLYAWMREFVKLLR
- Xem thêm -

Xem thêm: Nghiên cứu và khuyếch đại gene Tk 1284 mã hóa enzyme peptidase của vi khuẩn chịu nhiệt Thermonococcus kodakarensis KOD1, Nghiên cứu và khuyếch đại gene Tk 1284 mã hóa enzyme peptidase của vi khuẩn chịu nhiệt Thermonococcus kodakarensis KOD1, Nghiên cứu và khuyếch đại gene Tk 1284 mã hóa enzyme peptidase của vi khuẩn chịu nhiệt Thermonococcus kodakarensis KOD1

Gợi ý tài liệu liên quan cho bạn

Từ khóa liên quan

Nạp tiền Tải lên
Đăng ký
Đăng nhập