Robust optimization of radiation therapy accounting for geometric uncertainty

... affected by uncertainty It is therefore equally ROBUST OPTIMIZATION OF RADIATION THERAPY 23 important to account for uncertainty in multicriteria optimization as in singlecriterion optimization ... patients receive radiation therapy during their illness [54] The quality of radiation therapy treatment is of high consequence This thesis concerns optimization approaches for radiation therapy in ... min{z, 0} for the minimum ROBUST OPTIMIZATION OF RADIATION THERAPY 11 variant of the function and ρ(z) = max{z, 0} for the maximum variant, where z is a real number For an ROI consisting of the...

Báo cáo khoa học: "Comparison of conformal and intensity modulated radiation therapy techniques for treatment of pelvic tumors. Analysis of acute toxicity" pdf

... article as: Ferrigno et al.: Comparison of conformal and intensity modulated radiation therapy techniques for treatment of pelvic tumors Analysis of acute toxicity Radiation Oncology 2010 5:117 Submit ... Elective radiotherapy with intensity modulated radiation therapy (IMRT) technique in the treatment of pelvic lymph nodes and primary tumor region Analysis of acute toxicity Procedings of the 49th ... with intensitymodulated whole pelvic radiation therapy Int J Radiat Oncol Biol Phys 2003, 56:1354-1360 19 Beriwal S, Heron DE, Kim H, et al: Intensity- modulated radiotherapy for the treatment of...

Tài liệu THE ESSENTIALS OF FINANCE AND ACCOUNTING FOR NONFINANCIAL MANAGERS doc

... THE ESSENTIALS OF FINANCE AND ACCOUNTING FOR NONFINANCIAL MANAGERS This Page Intentionally Left Blank THE ESSENTIALS OF FINANCE AND ACCOUNTING FOR NONFINANCIAL MANAGERS EDWARD ... place when the owners of the company leave the profits of the company in the business rather than taking the money out of the company in the form of dividends The cumulative amount of this reinvestment ... descriptions and definitions of their components and gain an understanding of how they can help us and why we should understand them Accounting Defined Accounting is the process of recording past business...

Frontiers of Radiation Therapy and Oncology Vol. 34 doc

... Three-Dimensional Radiation Treatment Frontiers of Radiation Therapy and Oncology Vol 34 Series Editors John L Meyer, San Francisco, Calif W Hinkelbein, Berlin Symposium on 3-D Radiation Treatment: ... conformal and stereotactic techniques, dosimetry as well as in target volume concepts, and clinical studies have been performed This peer-reviewed volume of Frontiers of Radiation Therapy and Oncology ... mechanisms of acute radiation injury in diﬀerent organs Pathogenesis of Chronic Radiation Damage The pathogenesis of chronic radiation damage is even more complex than that of acute radiation damage and...

Báo cáo hóa học: " Optimization of capsid-incorporated antigens for a novel adenovirus vaccine approach" doc

... NSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAA SGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ SNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEK GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ ... CGGGATCCCGGTTTCTTCTGAGGCTTCTCG CGGGATCCGGTGGCGCAGGCGG 83RGD -(as) 83RGD - (a) CGGGATCCCAGGGGTTTGATCACCGGTTT CGGGATCCACCGAACAGGGCGGGG 3'HVR5-(as) 5'HVR2-(s) GGCATGTAAGAAATATGAGTGTCTGGG CTCACGTATTTGGGCAGGCGCC a antisense, ... of the epitope is achieved [10,13-16] Strategies advancing this "capsid incorporation" paradigm have evaluated a range of virion capsid proteins as well as a variety of antigens, model and pathogenic...

Báo cáo hóa học: " Research Article Optimization of Linear Precoded OFDM for High-Data-Rate UWB Systems" pptx

... Mbit/s Figure 6: LP -OFDM performance with channel model CM1 CONCLUSION In this paper, we have proposed a linear precoded multicarrier waveform, called LP -OFDM, for high data rate UWB applications ... Furthermore, Theorem shows that the LP -OFDM noise margin can never be lower than the OFDM noise margin The LP -OFDM system range is therefore larger than the OFDM system range This result was expected ... considered Frames of 150 OFDM symbols are used, and a diﬀerent channel realization is applied for each frame The performance is estimated for UWB channel models CM1 and CM2, in the case of perfect channel...

Báo cáo hóa học: " Research Article Optimization of Linear Precoded OFDM for High-Data-Rate UWB Systems" pdf

Báo cáo khoa học: "Effects of radiation therapy on tissue and serum concentrations of tumour associated trypsin inhibitor and their prognostic significance in rectal cancer patients" doc

... al.: Effects of radiation therapy on tissue and serum concentrations of tumour associated trypsin inhibitor and their prognostic significance in rectal cancer patients Radiation Oncology 2011 ... tumour- associated trypsin inhibitor with serine proteinases associated with coagulation and tumour invasion Biochem J 1988, 254:911-914 Stenman UH: Tumour- associated trypsin inhibitor and tumour- associated trypsin ... variety of proteins and activates other MSPs and MMPs [8,9] TATI is a trypsin inhibitor that balances concentrations of trypsin and also functions as a weak inhibitor of other serine proteinases...

Analysis, design and optimization of energy efficient protocols for wireless sensor networks

... ANALYSIS, DESIGN AND OPTIMIZATION OF ENERGY EFFICIENT PROTOCOLS FOR WIRELESS SENSOR NETWORKS HOANG DUC CHINH (B.Eng., Hanoi University of Technology, Vietnam) A THESIS SUBMITTED FOR THE ... 21 1.3.4 Energy Eﬃcient Routing and Optimization Methods in Wireless Sensor Networks 24 2.1 Introduction 24 2.2 Routing Protocols for Wireless Sensor Networks ... 3.2 43 Wireless Sensor Nodes’ Energy Model and Cluster Head Rotation for Balancing Energy 43 3.2.1 Energy Model of the Wireless Sensor Node ...

Development, evaluation and optimization of image based methods for monitoring crystallization processes

... DEVELOPMENT, EVALUATION AND OPTIMIZATION OF IMAGE BASED METHODS FOR MONITORING CRYSTALLIZATION PROCESSES ZHOU YING (M.Sc., National University of Singapore, B.Eng., Dalian University of Technology, ... Steps in image analysis of silica gel PVM image 59 Figure 3.10 Steps in image analysis of sea sand PVM image - 60 ix Figure 3.11 Steps in image analysis of sea salt PVM image ... specification of product quality in crystallization process, summarizes current in-situ instruments for crystallization process monitoring and control, and reviews the current state of the image- based...

Robust design of miniaturised spindle motors for hard disk drive

... ROBUST DESIGN OF MINIATURISED SPINDLE MOTORS FOR HARD DISK DRIVE GAO XIAN KE (M.Eng, B.Eng) A THESIS SUBMITTED FOR THE DEGREE OF DOCTOR OF PHILOSOPHY DEPARTMENT OF ELECTRICAL AND ... application of robust design in hard disk drive industry As the objective of the research is to formulate effective robust design approaches systematically for the design and optimization of miniaturized ... Introduction of this study is to formulate the effective robust design approaches systematically and generally for design and optimization of electromechanical systems in hard disk drive The design...

Adapting plan based re optimization of multiway join queries for streaming data

... satisﬁed in data- stream environments 2.2 Optimization for Streaming Data In this section, we will review approaches that are especially put forward for streaming settings, where queries are submitted ... intermediate results, and hence, they are the most challenging to re- optimize In this thesis, we concentrate on adapting plan- based re- optimization of multiway join queries over streaming data We ... which are actually representations of related schemas Then, queries are generated for each set and they are greedily chosen to run until all expressions are covered Lastly, chosen queries are executed...

Comparative study on optimization of continuous countercurrent extraction for licorice roots

... Comminution of licorice roots for extraction 43 2.2 Soxhlet extraction 43 2.3 Coventional extraction by maceration 44 2.4 Horizontal screw continuous countercurrent extraction 45 iii TABLE OF CONTENTS ... characteristics of licorice roots comminuted by cut milling for extraction study 68 Table Results of Soxhlet extraction 73 Table 10 Results of the optimization study for continuous countercurrent extraction ... extraction 52 Table The extraction conditions investigated in the orthogonal experimental design for continuous countercurrent extraction 53 Table Extraction conditions used in the optimization of...

optimization of upper making process for cost reduction

... Statement of Authentication I hereby certify that all material within this report titled Optimization of upper making process for cost reduction is accurate and reflect ... chart of PPH of stitching in months of 2015 and 2016 List of tables Table 1: Raw data of material waste of cutting in 2014 and 2015 Table 2: Raw data of efficiency rate of 2nd process ... data of PPH of stitching in 2014 and 2015 Table 4: Optimization proposals Table 5: Raw data of material waste of cutting in months of 2015 and 2016 Table 6: Raw data of efficiency rate of 2nd process...

Xem thêm

Từ khóa: 1 principles of radiation therapy of hodgkin lymphoma implications for development of cell therapy protocols for myocardial infarction the role of radiation therapy in renal cell carcinoma effect of radiation therapy xrt on craniofacial implants modulation of radiation responses opportunities for therapeuticexploitation principles indications and techniques of radiation therapy of lymphomas inﬂuence of ω 3 pufas on chemo or radiation therapy for cancer the physics aspects of intensity modulated radiation therapy for lung cancers mechanisms rationale and process of care for radiation therapy accounting for the cost of raising capital gaap accounting for cost of raising capital when comparing the direct writeoff method and the allowance method of accounting for uncollectible accounting for letters of credit fees accounting for standby letter of credit fees cash method of accounting for taxes chuyên đề điện xoay chiều theo dạng Nghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt nam Nghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoại Nghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấp Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Quản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninh Phát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninh Nghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chế Nghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúng Nghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000 Thơ nôm tứ tuyệt trào phúng hồ xuân hương Tổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Kiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2 Tranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vật Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘI HIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀM TÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ