Dynamical simulation and structural analysis

Tài liệu Báo cáo Y học: Purification, characterization, immunolocalization and structural analysis of the abundant cytoplasmic b-amylase from Calystegia sepium (hedge bindweed) rhizomes ppt

Tài liệu Báo cáo Y học: Purification, characterization, immunolocalization and structural analysis of the abundant cytoplasmic b-amylase from Calystegia sepium (hedge bindweed) rhizomes ppt
... b-amylase (Cys83, Cys96, Cys209 and Cys344) are homologous to those found in soybean b-amylase (Cys82, Cys97, Cys208 and Cys343) On the analogy of the soybean b-amylase, the active site of the ... for the b-amylase from C sepium using the X-ray coordinates of the soybean b-amylase (Fig 4) According to the Ramachandran plot of this model the f and c angles of most of the residues are in the ... Inhibition of the enzyme activity by glucose, maltose and cyclohexaamylose For the study of the enzyme inhibition by glucose, maltose and cyclohexaamylose b-amylase activity was measured using the iodine...
  • 11
  • 232
  • 0

Báo cáo khoa học: Purification and structural analysis of the novel glycoprotein allergen Cyn d 24, a pathogenesis-related protein PR-1, from Bermuda grass pollen pot

Báo cáo khoa học: Purification and structural analysis of the novel glycoprotein allergen Cyn d 24, a pathogenesis-related protein PR-1, from Bermuda grass pollen pot
... we have purified, cloned and characterized Cyn d 24 as a novel pathogenesis-related protein from BGP Additionally, the identification of Cyn d 24 has identified the involvement of a novel class of ... AGAD AADA.NA.VG D. D 113 Zea AYA.S A- QRQG LI GG FW AGAD.SASDA.GS.VS QY.DHDT.S 112 Nicotiana AYA.N S-Q.AA NL HGQ AE -GDFMTAAKA.EM.V QY.DHD 118 Cyn d 24 DQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIMCSYWPPGNYENQKPY ... Cloning and sequencing of cDNA encoding Cyn d 24 Cyn d 24-specific cDNA was obtained by cDNA synthesis and PCR amplification from total RNA isolated from BGP A sense primer, designed on the basis of...
  • 10
  • 232
  • 0

Báo cáo khóa học: Mutational and structural analysis of cobalt-containing nitrile hydratase on substrate and metal binding pdf

Báo cáo khóa học: Mutational and structural analysis of cobalt-containing nitrile hydratase on substrate and metal binding pdf
... of NHase seems to form a disulfide bond easily under oxidative conditions, if the site contains no metal ion The metal activator of NHase may incorporate a metal ion to prevent the formation of ... & Endo, I (1999) Functional expression of nitrile hydratase in Escherichia coli: requirement of a nitrile hydratase activator and post-translational modification of a ligand cysteine J Biochem ... of the substrate binding and metal specificity of a Co-type NHase Experimental procedures Kinetic study NHase activity was determined by measuring the hydration of acrylonitrile, methacrylonitrile,...
  • 10
  • 190
  • 0

Báo cáo Y học: A comparative biochemical and structural analysis of the intracellular chorismate mutase (Rv0948c) from Mycobacterium tuberculosis H37Rv and the secreted chorismate mutase (y2828) from Yersinia pestis pptx

Báo cáo Y học: A comparative biochemical and structural analysis of the intracellular chorismate mutase (Rv0948c) from Mycobacterium tuberculosis H37Rv and the secreted chorismate mutase (y2828) from Yersinia pestis pptx
... dehydrogenase and prephenate dehydratase catalyze the biosynthesis of tyrosine and phenylalanine, respectively As this biosynthetic pathway is absent in mammals but is essential for the survival of bacteria ... Reddy PT (2006) Biochemical and structural characterization of the secreted chorismate mutase (Rv1885c) from Mycobacterium tuberculosis H37Rv: an *AroQ enzyme not regulated by the aromatic amino ... cloning of the gene encoding the secreted CM from Yersinia pestis (*YpCM, y2 828), purification of the protein, investigation of the properties of the enzyme, and the crystal structure analysis of the...
  • 12
  • 191
  • 0

Validation of Communications Systems with SDL: The Art of SDL Simulation and Reachability Analysis pptx

Validation of Communications Systems with SDL: The Art of SDL Simulation and Reachability Analysis pptx
... SU B Validation of Communications Systems with SDL: The Art of SDL Simulation and Reachability Analysis Laurent Doldi  2003 John Wiley & Sons, Ltd ISBN: 0-470-85286-0 Simpo26 Validation of Communications ... of the specification before the target hardware and software platform is available: board, board support package, compiler and so on Validation of Communications Systems with SDL: The Art of SDL ... with the environment by transmitting and receiving signals (or remote variables or procedures) through channels and signal routes Validation of Communications Systems with SDL: The Art of SDL Simulation...
  • 311
  • 178
  • 0

báo cáo khoa học: " Characterization and structural analysis of wild type and a non-abscission mutant at the development funiculus (Def) locus in Pisum sativum L" pdf

báo cáo khoa học:
... and attachment of pea seeds to the replum in a pod of the def mutant pea The def mutant pea shows a swollen and thick funicle compared to the wild type Arrows indicate the AZ and ALZ in the wild ... growing of the plants, harvested materials, carried out the structural examination and drafted the manuscript YKL participated in designing the experiments, structural analysis and the drafting of the ... pea seed at stage 8.1 and (B) In mature pea seed at 2.1 (C) Higher magnification of the AZ development in the young pea seed in (A) (D) Higher magnification of the AZ in the mature pea seed in...
  • 7
  • 133
  • 0

Báo cáo y học: "A systematic comparative and structural analysis of protein phosphorylation sites based on the mtcPTM database" ppt

Báo cáo y học:
... residues, the other of tyrosines This grouping is based on the similar characteristics of serine and threonine, and the fact that they are usually targeted by the same protein kinases The study focused ... identity cut-off (>30%) very few sites were highly conserved (Figure 7a) Only less than 5% of the sites were strictly conserved across the alignments, and not more than 20% of the sites were conserved ... motif on the surface of the protein (Figure 10g) Its phosphorylation may affect the conformation of this motif, which is involved in RNA -protein interactions [70] Finally, the structure of the...
  • 20
  • 97
  • 0

Báo cáo y học: "Sequence and structural analysis of BTB domain proteins" pps

Báo cáo y học:
... vertebrate BTB- ZF and BBK proteins are more closely related, and cannot be separated by BLASTCLUST Long form of the BTB domain The majority of BTB domains from the BTB- ZF, BBK, MATHBTB, RhoBTB and BTB- basic ... some BTB- ankyrin proteins are composed of an amino-terminal BTB domain, a central helical region, 19 ankyrin repeats and a carboxy-terminal FYVE domain (a domain originally found in Fab1, YOTB, ... residues in PLZF (Figures and 4) The BTB domain from the BTB- ZF, BBK and MATH -BTB and BTB- bZip families are closely related (Figure 6) and contain mostly the long form of the domain, as discussed...
  • 18
  • 90
  • 0

Báo cáo y học: "Phylogenetic and structural analysis of centromeric DNA and kinetochore proteins" doc

Báo cáo y học:
  • 21
  • 105
  • 0

Tài liệu Báo cáo khoa học: Plasticity of S2–S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis pdf

Tài liệu Báo cáo khoa học: Plasticity of S2–S4 specificity pockets of executioner caspase-7 revealed by structural and kinetic analysis pdf
... demonstrate the plasticity of substrate recognition by caspase-7, and will be valuable for the design of inhibitors of this pharmacologically important enzyme Results Inhibition of caspase-7 by tetrapeptide ... et al Plasticity of caspase-7 specificity pockets was blocked in the crystal structure of caspase-3 in complex with the inhibitor of apoptosis protein XIAP [34] The S2 subsites of caspase-7 and ... identification of the small aliphatic binding region of the S4 subsite of caspase-7 The structure of caspase-7 ⁄ IEPD shows only one hydrogen bond between the main chain atoms of caspase-7 and P4, and lacks...
  • 14
  • 171
  • 0

Báo cáo khoa học: Structural and functional analysis of the interaction of the AAA-peroxins Pex1p and Pex6p pptx

Báo cáo khoa học: Structural and functional analysis of the interaction of the AAA-peroxins Pex1p and Pex6p pptx
... to the cytosol Here we confirm and extend earlier studies of these AAA-peroxins and give a further detailed functional analysis of their cassette structure and interaction The interaction of Pex1p ... for the Pex1p Pex6p interaction and their functional role in peroxisome biogenesis Results The contribution of Pex1p and Pex6p to peroxisomal biogenesis is well established on the basis of the ... revealed the presence of Pex6p in the precipitate of full-length Pex1p ProtA and also the presence of Pex1p in the full-length Pex6p ProtA-precipitate (Fig 1C,D) These data confirm the in vivo interaction...
  • 12
  • 218
  • 0

Báo cáo Y học: Structural analysis of deacylated lipopolysaccharide of Escherichia coli strains 2513 (R4 core-type) and F653 (R3 core-type) pot

Báo cáo Y học: Structural analysis of deacylated lipopolysaccharide of Escherichia coli strains 2513 (R4 core-type) and F653 (R3 core-type) pot
... mode of the mixture of oligosaccharides prior to HPAEC, of the isolated main oligosaccharide of deacylated LPS and of acylated purified LPS from E coli F2513 (R4 core-type) In addition, the deacylated ... LPS (R4 core-type) is as depicted in Fig Structural analysis of E coli F653 core-oligosaccharides (R3 core) We have subjected purified LPS from E coli F653 to alkaline deacylation by hot alkali and ... core-oligosaccharides of E coli F653 (R3- core) and determined NMR chemical shift values MATERIALS AND METHODS Bacteria and bacterial LPS E coli strains 2513 and F653 were cultivated and used for the isolation of...
  • 10
  • 224
  • 0

Báo cáo khoa học: Structural and mutational analysis of TenA protein (HP1287) from the Helicobacter pylori thiamin salvage pathway – evidence of a different substrate specificity doc

Báo cáo khoa học: Structural and mutational analysis of TenA protein (HP1287) from the Helicobacter pylori thiamin salvage pathway – evidence of a different substrate specificity doc
... (Stratagene, La Jolla, CA, USA) The primers used were: 5¢-TATATCATTCA GGATTATTTGTATCTTTTAGAATACGCTAAGGTG-3 ¢ (forward, the mutagenesis codon underlined) and 5¢-TT AGCGTATTCTAAAAGATACAAATAATCCTGAATGA ... Structure of H pylori TenA N Barison et al A B Fig TenA active site (A) Cartoon view of a detail of TenA active site The side chains of residues relevant for catalysis are shown for HP -TenA (left) and ... SE (2005) Structural characterization of the regulatory proteins TenA and TenI from Bacillus subtilis and identification of TenA as a thiaminase II Biochemistry 44, 231 9–2 329 Pang AS, Nathoo S &...
  • 9
  • 142
  • 0

Báo cáo khoa học: The CRIPTO/FRL-1/CRYPTIC (CFC) domain of human Cripto Functional and structural insights through disulfide structure analysis docx

Báo cáo khoa học: The CRIPTO/FRL-1/CRYPTIC (CFC) domain of human Cripto Functional and structural insights through disulfide structure analysis docx
... Structure of the human Cripto CFC domain (Eur J Biochem 270) 3615 Fig Alignment of the sequences of the CFC domain of human Cripto and PMP-C Conserved residues are framed with solid lines and homologous ... types of mutants, i.e the CFC domain mutant, H120G/W123G, and the EGF domain mutant, N85G/T88A, to bind to ALK4 Comparative modeling The 3-D structures of the EGF-like domain and the CFC domain ... 2003 Structure of the human Cripto CFC domain (Eur J Biochem 270) 3611 Generation of disulfide- linked CFC fragments of Cripto using CNBR and endoproteinase lys-c Fig The predicted sequence of human...
  • 9
  • 159
  • 0

Báo cáo khoa học: Structural and functional analysis of ataxin-2 and ataxin-3 potx

Báo cáo khoa học: Structural and functional analysis of ataxin-2 and ataxin-3 potx
... b5 strand) of D3 and F27/Y289 (b2 strand), L67/M324, V70/I327 and L72/L328 (all in b4 strand) of B The second cluster consists of P6/M267, L10/ L271 (both in a-helix), V18/C279 (b1 strand), L32/F293 ... solution structures of the UBL domain of hHR23A/B bound to a UIM peptide of S5a [99,119] could be used to model the complex of hHR23A/B and ataxin-3 Similarly, the complex of a UIM of ataxin-3 with ... detailed analysis of ataxin-2 homologues including the yeast homologue Pbp1, using a structurebased multiple sequence alignment of Sm and Sm-like proteins and a 3D model of the Lsm domain of ataxin-2...
  • 16
  • 99
  • 0

Xem thêm

Từ khóa: structural and chemical analysis of materialsmonte carlo simulation for reliability analysis of emergency and standby power systemsstructural and chemical analysis of materials pdfautodesk robot structural analysis tutorials and examples pdfautodesk robot structural analysis tutorials and examplesstructural and stress analysissimulation and analysis of the business processgrowth structural analysis and property measurementssimulation and analysis of manufacturing systemsstructural engineering and design analysis reportstructural analysis and designstructural and conformational analysis of oligosaccharides• analysis of morphological and structural alterations on mcf 7 and 4t1 cell lines• cell morphology and ultra structural analysisnominal and structural typingCHUONG 6 THI TRUONG SO CAP PHAT HANH CHUNG KHOANCHUONG 7 THI TRUONG THU CAP SO GIAO DICH CHUNG KHOAN TP HCMCHUONG 3 THI TRUONG CO PHIEUCHUONG 4 THI TRUONG TRAI PHIEUQuy tắc thống nhất về nhờ thu URC 522 tiếng anhPhân tích chỉ tiêu lợi nhuận công ty Kinh ĐôKẾT QUẢ HOẠT ĐỘNG SẢN XUẤT KINH DOANH VÀ HƯƠNG HƯỚNG PHÁT TRIỂN của công ty TNHH ECOS ELECTRONIC Việt NamDự án kinh doanh dòng son handmade HYOMĐề thi vào chuyên 20132014CÔNG TY CỔ PHẦN XUẤT NHẬP KHẨU THIẾT BỊ CÔNG NGHIỆP SAO ĐỎĐề thi vào chuyên 20132014De van tuyen sinh dai tra chuyen 2013 2014Đề chuyên sinh nam hoc 2013 2014Nhận dạng văn bản một số ngôn ngữ La Tinhgiải pháp đẩy mạnh xuất khẩu hàng dệt may của việt nam khi hiệp định tpp được kí kếtSecrets of Closing the Sale by Zig ZiglarẢnh hưởng của phật giáo nam tông đến đời sống tinh thần của đồng bào khmer tỉnh bạc liêuTieu luan phoi hop cac loai thi nghiemLUẬN VĂN TÀI CHÍNH NGÂN HÀNG NĂM 2016Presentation DOING 2
Nạp tiền Tải lên
Đăng ký
Đăng nhập