Functional Characterization of Chitin and Chitosan

Báo cáo khoa học: Expression and functional characterization of P2Y1 and P2Y12 nucleotide receptors in long-term serum-deprived glioma C6 cells ppt

Báo cáo khoa học: Expression and functional characterization of P2Y1 and P2Y12 nucleotide receptors in long-term serum-deprived glioma C6 cells ppt
... designated P2Y12 [15–17] Results from our laboratory revealed that both classic P2Y1 and P2Y12 receptors coexist in glioma C6 cells: P2Y1, linked to phospholipase C, and P2Y12 , inhibiting adenylate ... and P2Y1 and P2Y12 receptor protein expression and functional activity Examination of the effects of specific pharmacological agents (a single agonist and two specific antagonists of P2Y1 and P2Y12 ... characterized by increased expression of the P2Y12 receptor and low expression of the P2Y1 receptor In cells grown in medium containing 10% (v ⁄ v) fetal bovine serum, the expression ratio of the two receptors...
  • 13
  • 138
  • 0

Optimization of chitin and chitosan extraction from by product from white leg shrimp (penaeus vannamei) industry in vietnam to improve its quality and efficiency

Optimization of chitin and chitosan extraction from by product from white leg shrimp (penaeus vannamei) industry in vietnam to improve its quality and efficiency
... recovering chitin and protein hydrolysates from white leg shrimp shells with pepsin In addition, the information relevent to kinetics of the process and the linkage between protein, minerals and chitin ... Chitin Figure 3.39: Proposed procedue for recovering chitin and protein from heads of white leg shrimp Chitin Figure 3.40: Proposed procedue for recovering chitin and protein from shells of white ... technology which were integrated by physical, enzymatic and chemical methods allowed to innovate the production of chitin and chitosan from by- products of the manufacturing white leg shrimp The procedues...
  • 24
  • 342
  • 1

Cellular and molecular control of skeleton formation in fish insights from osteoblast ablation and functional characterization of lrp5 and SOst

Cellular and molecular control of skeleton formation in fish  insights from osteoblast ablation and functional characterization of lrp5 and SOst
...  51   3.2 FUNCTIONAL CHARACTERIZATION OF LRP5 AND  ITS  PUTATIVE  INHIBITOR SOST  DURING   CRANIOFACIAL SKELETON FORMATION    53   3.2.1 Lrp5 and Sost  are  conserved ...  EXPRESSION OF LRP5 AND  ITS  PUTATIVE  INHIBITOR SOST  DURING  CRANIAL   SKELETON  DEVELOPMENT IN  ZEBRAFISH    84   4.3  A  ROLE  FOR LRP5 AND SOST IN  MORPHOGENESIS OF  THE ...  Complementary and  overlapping  expression of Lrp5 and  its  putative  inhibitor Sost   during  cranial skeleton  development in  zebrafish    55   3.2.3 sost  but  not lrp5  expression...
  • 111
  • 91
  • 0

Functional characterization of HGF and its receptor c met in zebrafish development

Functional characterization of HGF and its receptor c met in zebrafish development
... paracrine signaling in liver development The coexpression of hgfa and c- met in pectoral fin, hgfb and c- met in proneprhic duct also indicate their paracrine signaling in the development of these ... Characterizing HGF and its receptor c- met s role in zebrafish development (Manuscript in preparation) v LIST OF FIGURES Fig.1.1 Schematic representation of proHGF/SF, HGF/ SF and the c- Met receptor ... X CHAPTER INTRODUCTION .1 1.1 Discovery of HGF and its receptor c- met 1.1.1 Discovery of HGF 1.1.2 Discovery of c- met and identification of c- met as the receptor...
  • 220
  • 42
  • 0

Application of chitin and chitosanbased materials for enzyme immobilizations: a review

Application of chitin and chitosanbased materials for enzyme immobilizations: a review
... chitin/ chitosan materials are eco-friendly, safe for humans and the natural environment Increasingly over the last decade chitin- and chitosanbased materials have been examined and a number of potential ... artificial cells and organs, and coating of artificial materials for better biocompatibility Offering a great potential in this area, real application of immobilized enzymes has as yet suffered ... [5] Areas of present and potential future applications of immobilized enzyme systems other than industrial (Table 1) include: laboratory scale organic synthesis, and analytical and medical applications...
  • 14
  • 151
  • 0

Tài liệu Báo cáo khoa học: Molecular modeling and functional characterization of the monomeric primase–polymerase domain from the Sulfolobus solfataricus plasmid pIT3 doc

Tài liệu Báo cáo khoa học: Molecular modeling and functional characterization of the monomeric primase–polymerase domain from the Sulfolobus solfataricus plasmid pIT3 doc
... mechanism of both RNA and DNA synthesis [17] In a previous study, we reported the findings of an analysis of the complete sequence of the cryptic plasmid pIT3 isolated from the crenarchaeon S solfataricus ... analyses of the predicted amino acid sequence showed that the C-terminal half of the RepA of the pIT3 plasmid is sequence-similar to the helicases of the phage-encoded superfamily III proteins The ... strand and the b9 strand to the b10 strand at the bottom of the Zn-stem loop in the pRN1 prim–pol structure However, because the Zn-stem loop is a fairly self-standing structure protruding from...
  • 14
  • 219
  • 0

Tài liệu Báo cáo khoa học: Molecular and functional characterization of adenylate kinase 2 gene from Leishmania donovani pdf

Tài liệu Báo cáo khoa học: Molecular and functional characterization of adenylate kinase 2 gene from Leishmania donovani pdf
... stearothermophilus adenylate kinase with bound Ap5A, Mg2+ Ap5A, and Mn2+ Ap5A reveal an intermediate lid position and six coordinate octahedral geometry for bound Mg2+ and Mn2+ Proteins 32, 27 6 28 8 29 Kanaani, ... M (1996) Ancient divergence of long and short isoforms of adenylate kinase: molecular evolution of the nucleoside monophosphate kinase family FEBS Lett 385, 21 4 22 0 Coombs, G.H (1986) Intermediary ... (19 92) Molecular characterization of cDNA encoding for adenylate kinase of rice (Oryza sativa L.) Plant J 2, 845–854 20 Brune, M., Schumann, R & Wittinghofer, F (1985) Cloning and sequencing of...
  • 9
  • 153
  • 0

Báo cáo khoa học: Molecular and functional characterization of novel CRFR1 isoforms from the skin pptx

Báo cáo khoa học: Molecular and functional characterization of novel CRFR1 isoforms from the skin pptx
... terminus of the CRFR1 isoforms (Fig 1C) The predicted masses of the isoforms without/with V5 tag are as follows: CRFR1a (47.7/52 kDa), CRFR1e1 (10.8/ 15.1 kDa), CRFR1e2 (28.1/32.4 kDa), CRFR1f ... CRFR1 a, b, c and d isoforms differ in their ability to bind ligands and activate G proteins [10,16,25] CRFR1a is the most efficient in the stimulation of cAMP production, CRFR1c and CRFR1b have ... independent of cAMP and IP3 [11,12,33] Neither CRFR1f, g or h isoforms were able to stimulate any of the cis-elements Instead the reporter gene expression decreased when these isoforms were cotransfected...
  • 10
  • 180
  • 0

Báo cáo khoa học: Molecular and functional characterization of a novel splice variant of ANKHD1 that lacks the KH domain and its role in cell survival and apoptosis docx

Báo cáo khoa học: Molecular and functional characterization of a novel splice variant of ANKHD1 that lacks the KH domain and its role in cell survival and apoptosis docx
... sequence VBARP-L 1.9 VBARP-S 1.3 AACAATGCTGACTGATAGCGGAGGA (Forward) TAAGCTACTACGTAAAGAATATATC (Reverse) GATAAGGTACCTGCACTGACACGGATGAAAGC (Forward) CATATATTCTTTACGTAGTAGCTTA (Reverse) FEBS Journal 272 ... identified and functionally characterized VBARP, a novel splice variant of ANKHD1 Human ANKHD1 gene is a large transcript containing multiple ankyrin repeat motif domains and a single KH domain similar ... Molecular characterization of ANKHD1 splice variant studies blast searches of VBARP revealed that this protein has homology to human ankyrin repeat and KH domain containing 1 (ANKHD1) variants,...
  • 12
  • 256
  • 0

Báo cáo khoa học: Sulfation of hydroxychlorobiphenyls Molecular cloning, expression, and functional characterization of zebrafish SULT1 sulfotransferases docx

Báo cáo khoa học: Sulfation of hydroxychlorobiphenyls Molecular cloning, expression, and functional characterization of zebrafish SULT1 sulfotransferases docx
... Detection of zebrafish SULT1 ST1 and ST2 mRNAs and (B) Western blot analysis of zebrafish SULT1 ST1 protein (A) Detection of zebrafish SULT1 ST1 and ST2 mRNAs in cultured zebrafish cells (lanes and 3) and ... sequence of zebrafish SULT1 ST1 displayed, respectively, 50%, 50%, and 49% identity to those of mouse SULT1C1, rat SULT1A1, and human SULT1A1 STs [22] The deduced amino acid sequence of zebrafish SULT1 ... of the regulation of the activity of the zebrafish ST by these divalent metal cations and their modes of action Fig Effects of divalent metal cations on the sulfating activity of the zebrafish SULT1...
  • 8
  • 179
  • 0

Báo cáo khoa học: Identification and functional characterization of a novel barnacle cement protein pptx

Báo cáo khoa học: Identification and functional characterization of a novel barnacle cement protein pptx
... VPPPCDFSIKSKQKQVGVTAGGASVSAKGATSGSGSITCITKTPTSVTKKVAAGNAGVSG Mrcp19k Bacp19k Bicp19k 70 80 90 100 110 120 TSVSAGDGAFGNLAAALTLVEDTEDGLGVKTKNGGKGFSEGTAAISQTAGANGGATVKKA VSASAANGFFKNLGKATTEVKTTKDGTKVKTKTAGKGKTGGTATTIQIADANGGVSEKSL AAAAAGNGVFKNLVTALTNISTTDDITKVQTQTIGSGGTGGAATILQLADANGGAALKEV ... underwater material surfaces was analyzed by: (a) quantitative amino acid analysis; and (b) SPR Protein adsorption to glass and a positively charged polymer were evaluated by quantification of the ... GC-3¢ and 5¢-AAC TCC GTG GAG AAG AAG AA-3¢ for the first PCR amplification; and 5¢-TGC TGA CCG ACG CGC CTC CT-3¢ and 5¢-GGC AAC ACG GGC GTC ACC GC-3¢ for the second PCR amplification The 102 bp DNA amplified...
  • 11
  • 168
  • 0

Báo cáo khoa học: Structural and functional characterization of human Iba proteins ppt

Báo cáo khoa học: Structural and functional characterization of human Iba proteins ppt
... cross-linking efciency of Iba1 and Iba2 or in the overall morphology of the generated lament bundles Calcium afnity of Iba1 and Iba2 Homodimerization and actin binding of Iba1 and Iba2 were similar ... presented here reveals functional similarities and differences between Iba1 and Iba2 We investigated Ca2+ binding and homodimerization of Iba1 and Iba2 Furthermore, F-actin binding and cross-linking ... Human Iba proteins J O Schulze et al study has revealed expression proles for most of the human transcripts and uncovered different tissuespecic expression of Iba1 and Iba2 [5] For Iba1 ,...
  • 14
  • 180
  • 0

Báo cáo khoa học: Functional characterization of artemin, a ferritin homolog synthesized in Artemia embryos during encystment and diapause doc

Báo cáo khoa học: Functional characterization of artemin, a ferritin homolog synthesized in Artemia embryos during encystment and diapause doc
... within negatively stained particles of artemin indicated the lack of metal storage capacity Function of an Artemia ferritin homolog A B C Artemin, apoferritin and ferritin inhibit citrate synthase ... denaturation Artemin, apoferritin and ferritin protected citrate synthase against denaturation at 43 °C in a concentrationdependent manner (Fig 3A C) Maximal protection was obtained at a chaperone ... strain BL21PRO (BD Biosciences Clontech) For expression in mammalian cells, artemin cDNA was amplified by PCR with primers 5¢-GATCCTCGAGTTAACTATAGAAGACACGGG-3¢ and 5¢-AGCTCCTAGGGCAACAGAAGGTGCAAG-3¢,...
  • 9
  • 199
  • 0

Báo cáo Y học: Structural and functional characterization of a C-type lectin-like antifreeze protein from rainbow smelt (Osmerus mordax) potx

Báo cáo Y học: Structural and functional characterization of a C-type lectin-like antifreeze protein from rainbow smelt (Osmerus mordax) potx
... digestion fragments of untreated and deglycosylated AFP 1222 J C Achenbach and K V Ewart (Eur J Biochem 269) Ó FEBS 2002 Fig Analysis of antifreeze activity Antifreeze activity was evaluated qualitatively ... chemicals were reagent grade Purification of smelt AFP Blood plasma was obtained from a population of rainbow smelt (O mordax) caught in seawater along the northeastern coast of Newfoundland on ... staining when CaCl2 is added to the staining and washing buffer (Fig 1) Measurement of antifreeze activity Antifreeze activity was measured on equimolar amounts of deglycosylated and untreated...
  • 8
  • 262
  • 0

Báo cáo khoa học: Purification and functional characterization of human 11b hydroxylase expressed in Escherichia coli doc

Báo cáo khoa học: Purification and functional characterization of human 11b hydroxylase expressed in Escherichia coli doc
... volume and energetic properties of the binding of CO to hemoproteins Biophys J 66, 89–98 Tuckey RC & Kamin H (1983) Kinetics of O2 and CO Binding to adrenal cytochrome P-450scc Effect of cholesterol, ... was in the range of values determined in previous studies for the interaction between bovine Adx and bCYP11B1 Biacore measurements were performed to investigate the binding behavior between bovine ... the functional and structural consequences of two point mutations (P94L and A368D) in the CYP11B1 gene causing congenital adrenal hyperplasia resulting from 11 -hydroxylase deficiency J Clin Endocrin...
  • 12
  • 154
  • 0

Xem thêm

Từ khóa: functional of chitin and chitosanbiomedical applications of chitin and chitosan derivativesmedical applications of chitin and chitosan going forwardindustrial applications of chitin and chitosan derivativesproperties of chitin and chitosanapplications of chitin and chitosanextraction of chitin and chitosanthermal oxide synthesis and characterization of fe3o4nanorods and fe2o3 nanowiresisolation and characterization of embryonic and adult epicardium and epicardium derived cellselectrochemical characterization of carbons and carbon alloysstructural and functional roles of fsh and lh as glycoproteins regulating reproduction in mammalintegration of the functional aspects of vitamins and mineralsminimax characterization of eigenvalues and the silvester apos s criterion of positivity6additional functional properties of paper and paperboardmetabolic pathway of chitin and its oligosaccharides in marine bacterium vibriosĐề thi thử THPT quốc gia,môn vật líMột số giải pháp hoàn thiện nghiệp vụ thanh toán thẻ tại Ngân hàng Ngoại thương Hà NộiTHỰC TRẠNG VÀ GIẢI PHÁP PHÁT TRIỂN CÂY BÓNG MÁT ĐƯỜNG PHỐ TRÊN ĐỊA BÀN THÀNH PHỐ THANH HOÁCác biện pháp tham mưu, xã hội hóa giáo dục tăng cường cơ sở vật chất cho trường mầm non, duy trì danh hiệu trường đạt chuẩn quốc gia”Một số biện pháp chỉ đạo giáo viên khối 5 tuổi nâng cao chất lượng thực hiện chương trình GDMNMột số biện pháp chỉ đạo nâng cao chất lượng cho trẻ làm quen với văn học ở trường mầm nonMột số biện pháp chuẩn bị cho trẻ mẫu giáo lớn 5 6 tuổi sẵn sàng vào lớp 1 ở trường mầm nonMột số biện pháp giúp trẻ 4 5 tuổi học tốt hoạt động làm quen văn học trường mầm nonMột số biện pháp nâng cao hiệu quả tổ chức trò chơi dân gian cho trẻ 5Một số biện pháp nhằm nâng cao chất lượng giáo dục phát triển thể chất cho trẻ 5 6 tuổi ở trường mầm nonMột số biện pháp phát triển ngôn ngữ cho trẻ 5 6 tuổi trường MN thông qua hđ kể truyện, đọc thơMột số kinh nghiệm giúp trẻ thích nghi với môi trường ở trường mầm nonMột số biện pháp nâng cao hiệu quả công tác kiểm tra của hiệu trưởng trường tiểu họcPhương pháp nghiên cứu khoa học giáo dục mầm nonThực hành giải toán tiểu học tập 1TỔNG HỢP LÝ THUYẾT TOÁN 12 ÔN THI THPT QUỐC GIAHướng dẫn phương pháp và rèn kĩ năng giải bài tập vật lý 8, 9MỘT số GIẢI PHÁP NHẰM NÂNG CAO CHẤT LƯỢNG TIẾT LUYỆN NÓI môn NGỮ văn ở TRƯỜNG THCSmột số kinh nghiệm khi dạy học sinh về phương trình bậc caoNâng cao chất lượng dạy chuyên đề bài tập phần gương phẳng