Báo cáo y học: " Identification of two distinct structural regions in a human porcine endogenous retrovirus receptor, HuPAR2, contributing to function for viral entry" docx

... c-myc tag wasinserted into the pcDNA3.1(+)/Zeo HuPAR2 backbone bysite-directed mutagenesis with the following primer pair:5'-CCAGCTTTGGGCTGAATGGAACAAAAACTTATTTCT-GAAGAA GATCTGATGGCAGCACCCACG ... populations were assayed for PERV -A binding and infection by a FACS-based PERV -A SU IgG binding assay and a PERV pol qPCR-based infection assay. PERV pol copy numbers were normal-ized to wild-type ... relationships of HuPAR1 and HuPAR2are not only important to further a general understanding of gammaretroviral cell entry, but also, central to advanc-ing a science-based risk-assessment for a...

Báo cáo y học: "Identification of novel DNA methylation inhibitors via a two-component reporter gene system" pptx

... strategy for cancertreatment as demonstrated by the US Food and Drug Administration approval of the DNA methyltransferaseinhibitors azacytidine and 5-aza-2’-deoxycytidine for the treatment of myelodysplastic ... f many diseasesincluding cancer [1-7], targeting aberrant DNA methyla-tion is considered as a therapeutically relevant strategy for cancer treatment. Among many agents with DNA methy-lation-modifying ... [10].Recently, procainamid e has emerged a s a pot entialDNA demethylating agent for clinical translation. Evi-dence indicates that procainamide inhibits DNMT1 byreducing the affinity with its two...

Báo cáo y học: "Identification of ciliary and ciliopathy genes in Caenorhabditis elegans through comparative genomics" pptx

... patterns of allremaining candidate X-box containing genes from Additionaldata file 2 will be ascertained in a separate study.SAGE data analysisIt is anticipated that the transcriptional expression ... protocol as detailed in the GeneChip ExpressionAnalysis Technical Manual (provided by Affymetrix, SantaClara, California, USA) [60].GeneChip hybridization, washing, staining, and scanning A hybridization ... (rRNAratio, RNA integrity number) were employed to ensure thehigh quality of extracted RNA. Good quality total RNA (5micrograms) was subjected to a standard eukaryotic targetpreparation protocol...

Báo cáo y học: " Identification of transcripts with enriched expression in the developing and adult'''' pptx

... (Pdx1); TAGTTTTAACAGAAAAC (Foxa2); ACCTTCACACCAAACAT (Hnf 4a) ; AATGCAGAGGAGGACTC (Neurod1); CAGGGTTTCTGAGCTTC (Neurog3); TCATTTGACTTTTTTTT (Isl1); GATTTAAGAGTTTTATC (Pax6); CAGCAGGACGGACTCAG (Pax4); ... CAGTCCATCAACGACGC (Ptf 1a) ; AGAAACAGCAGGGCCTG (Bhlhb8); GACCACACTGTCAAACA (Cpa1); CCCTGGGTTCAGGAGAT (Ctrb1); TTGCGCTTCCTGGTGTT (Ela1); ACCACCTGGTAACCGTA (Gcg); GCCGGGCCCTGGGGAAG (Ghrl); CTAAGAATTGCTTTAAA ... characterized in pancreasdevelopment, that are appropriately expressed spatially andtemporally to play functionally significant roles in each of themajor phases of pancreas development.Identification...

Báo cáo y học: "Activation of WNT and BMP signaling in adult human articular cartilage following mechanical injury" potx

... (GeneBank:NM_002422), for- ward 5'-CAACCGTGAGGAAAATCGATGCAG-3', reverse5'-CGGCAAGATACAGATTCACGCTCAA-3', 440 bp;MMP13 (GeneBank:NM_002427), forward 5'-ACGGAC-CCATACAGTTTGAATACAGC-3', ... catenin canonical pathway following mechani-cal injuryActivation of the WNT/β catenin canonical pathway following mechani-cal injury. (a) Axin-2 and (b) c-JUN mRNAs, two known transcriptional targets ... cartilage is capable of triggering a signaling machinerythat may play a role in joint surface repair.Although several risk factors for OA have been identified,including the nature and entity of...

Báo cáo y học: "Enrichment of intersubtype HIV-1 recombinants in a dual infection system using HIV-1 strain-specific siRNAs" pps

... recombinants by blocking each of two parental HIV-1 isolates in a dual infection with strain-specific siRNAs. Using this approach, we could easilydetect, map, and characterize intersubtype breakpoints in ... eventually all susceptible cells areexhausted for infection in the culture. Thus, parentalviruses (e.g. A and B) always dominate a dual infectionand b asically obscuring the characterization of ... Natl Acad Sci USA2005, 102:9002-9007.17. Quinones-Mateu ME, Gao Y, Ball SC, Marozsan AJ, Abraha A, Arts EJ: In vitrointersubtype recombinants of human immunodeficiency virus type 1:comparison...

Báo cáo y học: "dentification of the protease cleavage sites in a reconstituted Gag polyprotein of an HERV-K(HML-2) element" doc

... proteins previously identified by specificantisera. Fractions 43 to 46 gave two major bandsmigrating with apparent molecular masses of 15 kDaand approximately 18 kDa as wel l as an additionalweaker ... massspectra were visualized and processed using FlexAnalysissoftware and sequence tag hints were obtained by ana-lyzing tandem MS spectra employing the Biotools 3.0software (Bruker Daltonics). For ... associated with a variety of cancers andautoimmune diseases, a detailed knowledge of the fun-damental viral characteristics may help us elucidate themolecular and potentially pathogenic nature of...

Báo cáo y học: " Use of different but overlapping determinants in a retrovirus receptor accounts for non-reciprocal interference between xenotropic and polytropic murine leukemia viruses" ppt

... YYEGVAVLGTYSNHTSAPANCSVASQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLAAPAGTIWACNTGLT 399 AKR6 YYEGVAVLGTYSNHTSAPANCSVTSQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLASPAGTIWACSTGLT 400 1E YYEGVAVLGTYSNHTSAPANCSAASQHKLTLSEVTGRGLCIGTVPKTHQALCNTTLKTGKGSYYLVAPAGTMWACNTGLT ... phosphate-buff-ered saline. Endogenous alkaline phosphatase was inacti-vated by incubating the cells at 68°C for 1 h. Cells werethen stained for alkaline phosphatase activity by incubat-ing ... 1,000CHO/AAAU cellsFluorescenceCell numberAKR6 +8 3A2 5 +secondaryantibody8 3A2 5 +secondaryantibodyAKR6 +8 3A2 5 +secondaryantibody8 3A2 5 +secondaryantibodyAKR6 +8 3A2 5 +secondaryantibody8 3A2 5...

Báo cáo y học: "Simultaneous sleep study and nasoendoscopic investigation in a patient with obstructive sleep apnoea syndrome refractory to continuous positive airway pressure: a case report" ppt

... specifically bi-maxillary surgery, isalso effective in severe cases of OSAS. It may beconsidered for patients who are unwilling to use, or arerefractory to, nC PAP therapy and whose anatomicalchanges ... physical exam revealedmacroglossia, a bulky soft palate and uvula. He wasoverweightwithabodymassindex(BMI )of2 9.1andhad a cervical perimeter of 42 cm. As an initial diagnosticapproach, a spirometry ... 2 A cardiorespiratory study in the use of a mandibular advancement device. An evaluation at 4 months with a cardiorespiratory study in the use of a mandibular advancement device (first 3.5 h of...

Báo cáo y học: " Identification of arthritis-related gene clusters by microarray analysis of two independent mouse models for rheumatoid arthritis" pdf

... M, Yoshida E, Takiguchi M, Sato K, Kitajima I,Nishioka K, Yamamoto K, Takeda T, Hatanaka M, et al.: Induction of inflammatory arthropathy resembling rheumatoid arthritis in mice transgenic for ... HTLV-I and HTLV-II Volume 2. New York: Plenum Press; 1993. 7. Iwakura Y, Saijo S, Kioka Y, Nakayama-Yamada J, Itagaki K, TosuM, Asano M, Kanai Y, Kakimoto K: Autoimmunity induction by human T ... Horai R, Saijo S, Tanioka H, Nakae S, Sudo K, Okahara A, Ikuse T,Asano M, Iwakura Y: Development of chronic inflammatoryarthropathy resembling rheumatoid arthritis in interleukin 1receptor antagonist-deficient...

Xem thêm

Từ khóa: Nghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoại Một số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTP Biện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọ Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit ĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN Phát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninh Nghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùng Định tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Thơ nôm tứ tuyệt trào phúng hồ xuân hương Sở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIX chuong 1 tong quan quan tri rui ro Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Trách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)HIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀM TÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ QUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ