0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Báo cáo khoa học: "Rapid molecular detection of methicillin-resistant Staphylococcus aureus: a cost-effective tool for infection control in critical care" pdf

Báo cáo khoa học:

Báo cáo khoa học: "Rapid molecular detection of methicillin-resistant Staphylococcus aureus: a cost-effective tool for infection control in critical care" pdf

... specificity[1]. Mathematical modeling suggest that using a rapid PCRassay for MRSA admission screening and patient isolationshould reduce significantly the incidence of hospital-acquiredMRSA infection and ... number of unnecessary pre-emptive isolation days avoided, the increase in the MRSAdecolonization rate, the decrease in the MRSA transmissionand infection rate, the decrease in MRSA-related mortality,the ... methicillin-resistant Staphylococcus aureus? ClinInfect Dis 2005, 40:405-409.6. Verbrugh HA: Value of screening and isolation for control of methicillin-resistant Staphylococcus aureus. Clin Infect...
  • 3
  • 221
  • 0
Báo cáo khoa hoc:

Báo cáo khoa hoc:" Light triggered detection of aminophenyl phosphate with a quantum dot based enzyme electrode" ppsx

... phosphatase as a label for immunoassay using amperometric detection with a variety of substrates and an optimal buffer system. Analytica Chimica Acta 1999,393:95-102.22. Campas M, Olteanu MG, Marty ... shown in Figure 6. A maximum of photocurrent was detected for anapplied bias potential of +200 mV against Ag/AgCl, 3MKCL (data are shown in Additional File 1). For thisreason all following measurements ... Serum. Clinica ChimicaActa 1964, 9:392-&.27. Kind PRN, King EJ: Estimation Of Plasma Phosphatase By Determination Of Hydrolysed Phenol With Amino-Antipyrine. Journal Of ClinicalPathology 1954,...
  • 10
  • 239
  • 0
Tài liệu Báo cáo khoa học: The molecular surface of proteolytic enzymes has an important role in stability of the enzymatic activity in extraordinary environments pptx

Tài liệu Báo cáo khoa học: The molecular surface of proteolytic enzymes has an important role in stability of the enzymatic activity in extraordinary environments pptx

... 5¢-TAATATTGACcCCgGGCGCCAcAATCTCAAG-3¢ SmaIY259Q 5¢-GCCATTTCCATAtTgaGTaCTGTTACCAAG-3¢ ScaID266N 5¢-CATACTCAGCgTtaACTAAGCCATTTC-3¢ HpaIY26 9A 5¢-TTGAGCCGCAgcCTCAGCgTCgAC TAAGCCATTTC-3¢ SalIQ272R 5¢-CTTAGGGATTAacGAGCCGCATACTCAGCgTCgAC ... GGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTATYLGNSFYYGKGLINVQAAAQJ 211 GGTYGAYNGTSMATTHVAGAAALILSKHPTWTNAQVRDRLESTATYLGNSFYYGKGLINVQAAAQAMYL 211 GGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTATYLGNSFYYGKGLINVQAAAQBPN' 211 GNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQMECE ... SATSRGVLVVAASGNSGA-GSIS YPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYP221 139 SATSRGVLVVAASGNSGA-GSIS YPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPSAVI 138 SATSRGVLVVAASGNSGA-GSIS YPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPSEND...
  • 9
  • 489
  • 0
Báo cáo khoa học: The molecular identity of the mitochondrial Ca2+ sequestration system potx

Báo cáo khoa học: The molecular identity of the mitochondrial Ca2+ sequestration system potx

... the Ca2+-binding pro-teins mitocalcin [46], calbindin-28k and calbindin-30k(calretinin) in a particulate fraction of rat brain [47]and in brain mitochondria [48,49] has been demon-strated ... high-affinity Ca2+binding that was inhibited by ruthenium red andLa3+. These preparations showed a single band of approximately 30 kDa on PAGE, and contained sialicacid and neutral and amino sugars, ... mitochondria requires co-trans-port of an IM-permeable anion such as acetate orphosphate. In the latter case, the accumulated Ca2+forms a precipitate in the matrix of mitochondria in anapparently...
  • 12
  • 533
  • 0
Báo cáo khoa học: The molecular basis of heme oxygenase deficiency in the pcd1 mutant of pea pot

Báo cáo khoa học: The molecular basis of heme oxygenase deficiency in the pcd1 mutant of pea pot

... primersPS1 .FOR 5¢-GAG GAN ATG AGN TTN GTN GCNATG AGA-3¢ and PS1.REV 5¢-CCA CCA GCA NTATGN GNA AAG TAG AT-3¢. Amplification products wereligated into pCR2.1 (TOPO TA cloning kit; Invitrogen Ltd,Paisley, ... becomes a Val or Leu in mammalian and other animal ⁄ bacterial sequences,respectively, Ile214 is a Leu in cyanobacterial and ani-mal HOs, Tyr231 is a Phe in animal sequences andSer274 is always ... byphytochrome and a plastid signal during de-etiolation in Arabidopsis thaliana. Plant J 25, 549–561.54 Sambrook J & Russell DW (2001) Molecular Cloning – a Laboratory Manual. Cold Spring Harbor LaboratoryPress,...
  • 13
  • 402
  • 0
Báo cáo khoa học:

Báo cáo khoa học: " Improved Automatic Detection of Zero Subjects and Impersonal Constructions in Spanish" docx

... 1–7.Real Academia Espa˜nola. 2001. Diccionario de lalengua espa˜nola. Espasa-Calpe, Madrid, 22 edi-tion.Real Academia Espa˜nola. 2009. Nueva gram´atica dela lengua espa˜nola. Espasa-Calpe, ... Elliphantusing the training data randomly ordered. Theperformance reaches its plateau using 90% of thetraining instances. Using different ordering of thetraining set we obtain the same result.Figure ... presence or absence of a sub-ject in the clause, as identified by the parser.We are not aware of a formal evaluation of Connexor’s accuracy. It presents an accu-racy of 74.9% evaluated against our...
  • 10
  • 406
  • 0
báo cáo hóa học:

báo cáo hóa học:" Rapid serological detection of autoantibodies associated with Sjögren''''s syndrome" docx

... Hirai H, Leahy H, Lernmark A, Ivarsson SA, Iadarola MJ,Notkins AL: A new luminescence assay for autoantibodies tomammalian cell-prepared insulinoma-associated protein 2.Diabetes Care 2008, ... Section, Laboratory of Sensory Biology, National Institute of Craniofacial Research, National Institutes of Health, Bethesda, Maryland, USA and 2Division of Rheumatology and Clinical Immunology and ... results also suggest that performing QLIPS and LIPS in parallel may allow a simple method of more accuratelyassessing antibody avidity in some situations. An analo-gous increase in specificity of...
  • 8
  • 454
  • 0
báo cáo khoa học:

báo cáo khoa học: "Rapid self-assembly of DNA on a microfluidic chip" docx

... have developed a method of rapidly disassemblingand re-assembling DNA within a microfluidic chip, allow-ing us control over the relative amount of ss and dsDNAand enabling the performance of ... University of Alberta, Edmonton, Alberta, CanadaEmail: Yao Zheng - zheng@ualberta.ca; Tim Footz - tfootz@ualberta.ca; Dammika P Manage - manage@ece.ualberta.ca; Christopher James Backhouse* ... hybridisation, sizing, heteroduplex analysisand single-stranded conformation analysis within a matter of minutes. The rapidity of this analysisallows the sampling of transient effects that may improve...
  • 10
  • 354
  • 0
báo cáo khoa học:

báo cáo khoa học: "C60-Fullerenes: detection of intracellular photoluminescence and lack of cytotoxic effects" pdf

... negative ionmode (data not shown). Each of the preparations con-tained a small amount of a species at 489.64 Da that waspresent in the original preparation of C60. In all cases, theprincipal ... following integrin activationinvolves a series of complex signaling events beginningwith integrin activation and orchestrated activation of Rho GTPases [40], our results suggest that treatment of C60 ... (MCF1 0A) and malignant (MDA MB 435 andMDA MB 231) human mammary epithelial cell lines, andhuman liver carcinoma cell line (HepG2) were obtainedfrom the American Type Culture Collection (Manassas,VA)...
  • 11
  • 287
  • 0

Xem thêm

Từ khóa: báo cáo khoa học mẫubáo cáo khoa học y họcbáo cáo khoa học sinh họcbáo cáo khoa học nông nghiệpbáo cáo khoa học lâm nghiệpbáo cáo khoa học thủy sảnbáo cáo khoa học về cá trabáo cáo khoa học nghiên cứu chôm chômtrạng thái hiện sinh báo cáo khoa họcbiểu tượng văn học báo cáo khoa họctài liệu báo cáo khoa họccách trình bày báo cáo khoa họcbáo cáo khoa học toán họccách làm báo cáo khoa họctrình bày báo cáo khoa họcBáo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018Nghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngBáo cáo quy trình mua hàng CT CP Công Nghệ NPVchuyên đề điện xoay chiều theo dạngNghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiMột số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùngNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Định tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinThơ nôm tứ tuyệt trào phúng hồ xuân hươngThiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khíGiáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtHIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀM