0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

báo cáo khoa học: "Topoisomerase II alpha gene copy loss has adverse prognostic significance in ERBB2-amplified breast cancer: a retrospective study of paraffin-embedded tumor specimens and medical charts" ppsx

báo cáo khoa học:

báo cáo khoa học: "Topoisomerase II alpha gene copy loss has adverse prognostic significance in ERBB2-amplified breast cancer: a retrospective study of paraffin-embedded tumor specimens and medical charts" ppsx

... Parwaresch R: Prognostic significance of Ki-67 and topoisomerase II expression in infiltrating ductal carcinoma of the breast. a multivariateanalysis of 863 cases. Breast Cancer Research 1999, ... regression. SASversion 9.0 and the R statistical software were used in thedata analysis. All reported p-values are two-sided.List of AbbreviationsBC: Breast carcinoma; TOP 2A: Topoisomerase II alpha; FISH: ... Slamon DJ: Topoisomerase II- alpha gene amplification as a predictor of responsiveness to anthracycline-containingchemotherapy in the Cancer International Research Group006 clinical trial of...
  • 10
  • 375
  • 0
Báo cáo khoa học: Disruption of the gene encoding 3b-hydroxysterol D14-reductase (Tm7sf2) in mice does not impair cholesterol biosynthesis pdf

Báo cáo khoa học: Disruption of the gene encoding 3b-hydroxysterol D14-reductase (Tm7sf2) in mice does not impair cholesterol biosynthesis pdf

... C27D8forma-tion and C27D8,14disappearance, evaluated as the peakarea ratio between the individual sterol and cholestane,the internal standard.No enzymatic activity was detected in liver ... dynamics and reassembly in living cells: tar-geting of an inner nuclear membrane protein in inter-phase and mitosis. J Cell Biol 138, 1193–1206.26 Hoffmann K, Sperling K, Olins AL & Olins ... Sdc4:forward, 5¢-GCGGCTCGGATGACTTTG-3¢; reverse, 5¢-AAGGGCTCAATCACTTCAGG-3¢. Cib3: forward, 5¢-ATGACTTCAACAATGACAACTAC-3¢; reverse, 5¢-ATCCAGCACCTTCTCACAG-3¢. Cyp 4a1 0 ⁄ 31: forward, 5¢-GCCTCTGTGCTCGGTCTG-3¢;...
  • 14
  • 299
  • 0
Tài liệu Báo cáo khoa học: The molecular surface of proteolytic enzymes has an important role in stability of the enzymatic activity in extraordinary environments pptx

Tài liệu Báo cáo khoa học: The molecular surface of proteolytic enzymes has an important role in stability of the enzymatic activity in extraordinary environments pptx

... 5¢-GCCATTTCCATAtTgaGTaCTGTTACCAAG-3¢ ScaID266N 5¢-CATACTCAGCgTtaACTAAGCCATTTC-3¢ HpaIY26 9A 5¢-TTGAGCCGCAgcCTCAGCgTCgAC TAAGCCATTTC-3¢ SalIQ272R 5¢-CTTAGGGATTAacGAGCCGCATACTCAGCgTCgAC TAAGCCATTTC-3¢ HpaID266N/Y26 9A ... GGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTATYLGNSFYYGKGLINVQAAAQJ 211 GGTYGAYNGTSMATTHVAGAAALILSKHPTWTNAQVRDRLESTATYLGNSFYYGKGLINVQAAAQAMYL 211 GGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTATYLGNSFYYGKGLINVQAAAQBPN' 211 GNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQMECE ... Nd5¢-TTAACCTTCAtatgTGAGGGTATTTTTTG-3¢ NdeINAT + Nd 5¢-TTTGCTTCTCAtatgTTACCCTCTCC-6¢ NdeII7V 5¢-AATATAAGGGAcTCCCCAtGGAACAGTCTG-3¢ NcoIQ18R 5¢-CCCAAAGTAAGGTcGACGgTGcACAACATCCGA-3¢ ApaLII108L 5¢-ATTCATCGCCCAcTCgAgTCCTTGAGCAAT-3¢...
  • 9
  • 489
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "Influence of decaying wood on chemical properties of forest floors and surface mineral soils: a pilot study" pptx

... were also analyzed foroxalate Fe and Al and dithionite Fe, Al and Si.Oxalate Fe and Al were extracted using acidammonium oxalate extraction, and dithionite Fe,Al and ... by analyses of P using a Technicon Autoanalyzer. ExtractableSO4-S was determined by ammonium acetateextraction (Tabatabai, 1982) and turbidimetry.Extractable Ca, Mg and ... delineates the sphere of influence of a dry cool mesothermal climate (Klinkaet al, 1991). The park has a mean annual precip-itation of 1 258 mm and a mean annual tempera-ture...
  • 11
  • 389
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "Comparison of intraoperative frozen section analysis for sentinel lymph node biopsy during breast cancer surgery for invasive lobular carcinoma and invasive ductal carcinoma" docx

... SLNs in cases of invasive lobularcarcinoma (ILC) versus that of invasive ductal carcinoma (IDC) has generated controversysecondary to a frequently low-grade cytologic appearance and an often ... T, Huhtala H, Holli K: A comparison of the biological and clinical features of invasive lobular and ductal carcino-mas of the breast. Breast Cancer Res Treat 2004, 85:23-39.33. Molland JG, ... mainstreampractice of intraoperative frozen section analysis for SLNbiopsy during breast cancer surgery.Table 1: Patient and tumor demographics for invasive lobular carcinomas and invasive ductal...
  • 8
  • 364
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "Correlation of HER-2 over-expression with clinico-pathological parameters in Tunisian breast carcinoma" ppsx

... breast carcinomaLobna Ayadi*1, Abdelmajid Khabir1, Habib Amouri2, Sondes Karray3, Abdallah Dammak2, Mohamed Guermazi2 and Tahya Boudawara1Address: 1Department of Pathology, Habib ... ayadilobna@yahoo.fr; Abdelmajid Khabir - akabdelmajid@yahoo.fr; Habib Amouri - amouri_hab@yahoo.fr; Sondes Karray - sondes.karray@yahoo.fr; Abdallah Dammak - abdallah@yahoo.fr; Mohamed Guermazi - ... med_guer@yahoo.fr; Tahya Boudawara - tahya.sellami@yahoo.fr* Corresponding author AbstractBackground: Breast carcinoma is a disease with a tremendous heterogeneity in its clinicalbehavior. Newer prognostic...
  • 8
  • 381
  • 0
báo cáo hóa học:

báo cáo hóa học: "Effect of step-synchronized vibration stimulation of soles on gait in Parkinson''''s disease: a pilot study" doc

... caused by a dopamine defi-ciency in the basal ganglia that results in characteristicmotor abnormalities including postural instability and gait impairment. Short shuffling steps, slow walkingspeed, ... studies showed that stim-ulation of the metacarpal joints activated ipsilateral sen-sory cortical areas and contralateral basal ganglia [32].Results of this study, however, may be not applied to ... walkingspeed, and increased stride variability characterize abnor-mal gait in PD. Although PD is primarily a motor disease,accumulating evidence suggests that abnormal proprio-ception and kinesthesia...
  • 7
  • 497
  • 0
Tài liệu Báo cáo khoa học: The alr2505 (osiS) gene from Anabaena sp. strain PCC7120 encodes a cysteine desulfurase induced by oxidative stress docx

Tài liệu Báo cáo khoa học: The alr2505 (osiS) gene from Anabaena sp. strain PCC7120 encodes a cysteine desulfurase induced by oxidative stress docx

... similar to that of IscS(Fig. 1A) , with a two-domain organization and thepresence of both a- helices and b-strands. On the basis of these data and the fact that alr2505-expression isspecifically induced ... After DNA sequencing analysis,recombinant plasmids were introduced in E. coli strains.osiS expression was induced using arabinose.Expression and purification of recombinantproteins A DNA fragment ... (osiS) gene from Anabaena sp. strain PCC7120encodes a cysteine desulfurase induced by oxidative stressMarion Ruiz, Azzeddine Bettache, Annick Janicki, Daniel Vinella, Cheng-Cai Zhang and Amel LatifiAix-Marseille...
  • 11
  • 728
  • 0
Tài liệu Báo cáo khoa học: Hsp105b upregulates hsp70 gene expression through signal transducer and activator of transcription-3 pdf

Tài liệu Báo cáo khoa học: Hsp105b upregulates hsp70 gene expression through signal transducer and activator of transcription-3 pdf

... CGA TGGATA CAG A- 3¢; reverse, 5¢-AGG ACA GTA GAA TTAGGT CAC T-3¢).Knockdown of Hsp10 5a and Hsp105bThe double-stranded RNA targeting Hsp105 (Dharmacon;5¢-GCA AAU CAC UCA UGC AAA CUU-3¢) was ... Stephanou A, Isenberg DA, Nakajima K & LatchmanDS (1999) Signal transducer and activator of transcrip-tion-1 and heat shock factor-1 interact and activate thetranscription of the Hsp-70 and ... TGTCCCCTCCAGTGAATCCCAGAAntisense GGGTTATGTTAGCTCAGTTACAGTApGL70()194) Sense ACTCTGGAGAGTTCTGAGCAGAntisense GGGTTATGTTAGCTCAGTTACAGTAMechanism of Hsp105b-induced Hsp70 expression N. Yamagishi et al.5878...
  • 11
  • 584
  • 0
Tài liệu Báo cáo khoa học: Induction of uPA gene expression by the blockage of E-cadherin via Src- and Shc-dependent Erk signaling docx

Tài liệu Báo cáo khoa học: Induction of uPA gene expression by the blockage of E-cadherin via Src- and Shc-dependent Erk signaling docx

... ectodomain of E-cadherin can be detached by ma-trilysin and stomilysin-1, releasing an 80 kDaA solubleE-cadherin fragment (sE-cad) [10]. sE-cad has beenfound in urine and serum of cancer patients ... 2006 The Authors Journal compilation ª 2006 FEBS 237domain), 5¢-CUACUUGGUUCGGUACAUGGG-3¢ and 5¢-CAUGUACCGAACCAAGUAGGA-3¢; control siRNA5¢-GUACCUGACUAGUCGCAGAAG-3¢ and 5¢-UCUGCGACUAGUCAGGUACGG-3¢. ... byDecma elicits a signaling pathway downstream of E-cadherin that leads toSrc-dependent Shc and extracellular regulated kinase (Erk) activation and results in uPA gene activation. siRNA-mediated...
  • 14
  • 599
  • 0

Xem thêm

Từ khóa: báo cáo khoa học mẫubáo cáo khoa học y họcbáo cáo khoa học sinh họcbáo cáo khoa học nông nghiệpbáo cáo khoa học lâm nghiệpbáo cáo khoa học thủy sảnbáo cáo khoa học về cá trabáo cáo khoa học nghiên cứu chôm chômtrạng thái hiện sinh báo cáo khoa họcbiểu tượng văn học báo cáo khoa họctài liệu báo cáo khoa họccách trình bày báo cáo khoa họcbáo cáo khoa học toán họccách làm báo cáo khoa họctrình bày báo cáo khoa họcNghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANNghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chếĐịnh tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Thiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khíChuong 2 nhận dạng rui roKiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIChiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015Đổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namHIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀMMÔN TRUYỀN THÔNG MARKETING TÍCH HỢP