báo cáo khoa học: "The expression and role of protein kinase C (PKC) epsilon in clear cell renal cell carcinoma" ppt
Tài liệu Báo cáo khoa học: The isolation and characterization of cytochrome c nitrite reductase subunits (NrfA and NrfH) from Desulfovibrio desulfuricans ATCC 27774 Re-evaluation of the spectroscopic data and redox properties ppt
... Biochem. 270) 3905 The isolation and characterization of cytochrome c nitrite reductase subunits (NrfA and NrfH) from Desulfovibrio desulfuricans ATCC 27774 Re-evaluation of the spectroscopic data ... coredescription and the spectroscopic and redox properties of each identified heme from the NrfHA complex.ConclusionsD. desulfuricans ATCC 27774 ccNiR is isolated as a mix-ture of high molecular ... this communication, we report for the first time the isolation and biochemical characterization of D. desulfuri-cans ATCC 27774 ccNiR subunits. The stoichiometrybetween NrfH and NrfA is discussed....
- 12
- 593
- 0
Tài liệu Báo cáo khoa học: "The Structure and Process of Talking About Doing" pdf
... of data on problem solving and talk about problem solving, 2) development of a process model of these behaviors, and 3) use of coding techniques to extract traces of "critical phenomena" ... model of the role of point of view in problem solving. SUMMARY We have reported here a three pronged approach to the study of problem solving action and report: I) the collected of data ... efforts on two types of problem solving phenomena: the changes in the problem solver's organization of the problem ("point of view"), and systematic multl-utterance structures used...
- 4
- 584
- 0
Báo cáo khoa học: Cloning, expression and interaction of human T-cell receptors with the bacterial superantigen SSA ppt
... Consequently, the molecularstudies of the interaction of SAgs with their s pecifics ligandswill not only advance understanding of the physiologicalmechanisms of these molecules, but may lead to the development ... Fig. 1B–D, expression of the mutant yields only monomeric SSA, free of dimer. T-cell proliferation assayWe next analyzed the ability of recombinant SSA tostimulate human T-cells. All SSA preparations ... bearing T-cell subsets are expanded by interaction with SSA. Someauthors indicated clonal expansion of T-cells bearing human Vb3, Vb12, Vb17 and Vb19 [20]. Others showedproliferation of human T-cells...
- 9
- 485
- 0
Báo cáo khoa học: Cloning, expression and characterization of a new aspartate aminotransferase from Bacillus subtilis B3 docx
... GGCGCGACGCACGAAAATTACGCK270H-R GTCTATTTTCACGCAAAGCACCCGGTR403Y-F AAACCGATTTGTACATCGCATTTTCR403Y-R CATTAATGGATATCGTTCCGATTCCH J. Wu et al. Identification of a new aspartate aminotransferase FEBS ... Multispecific aspartate and aromatic amino acid aminotransferases inEscherichia coli. J Biol Chem 250, 4128–4133.38 Yagi T, Kagamiyama H, Nozaki M & Soda K (1985)Glutamate -aspartate transaminase from ... L-glutamate.The activity of L -aspartate was adjusted to 100.b30 mML -aspartate was used as amino donor for a- ketoglutarate, and 30 mML-gluta-mate was used as amino donor for oxaloacetate. The activity...
- 13
- 490
- 0
Báo cáo khoa học: Structure, expression and regulation of the cannabinoid receptor gene (CB1 ) in Huntington’s disease transgenic mice ppt
... 27 1) Ó FEBS 2004 Structure, expression and regulation of the cannabinoid receptor gene (CB1 ) in Huntington’s disease transgenic mice Elizabeth A. McCaw, Haibei Hu, Geraldine T. Gomez, Andrea ... describing the gene structure of CB1 and i ts pattern of expression in transgenic mice will provide the information necessary to determinehow mutant huntingtin alters the expression of this ... dependent on the l ength o f t he CAG trinucleotide (nt) repeat and relative expression of the HD gene. W e then determined the structure of the mouse CB1 gene and determined thattranscription of t...
- 12
- 504
- 0
Báo cáo khoa học: "THE SYNTAX AND SEMANTICS OF USER-DEFINED MODIFIERS IN A TRANSPORTABLE NATURAL LANGUAGE PROCESSOR" pot
... portable natural language data base interface. Cmlf. on Ap'1)lied Nc~t~ral L~znguage Processing, Santa Munica, Ca., 1983, pp. 25-30. 25. Grosz, B. TEAM: A transportable natural language ... grammatical formalism for transportable natural language processing, llm~r. J. Cow~p~t~zt~na~ L~n~ist~cs, to appear. Biermann, A. and Ballard, B. Toward natural language computation. Am~r. ... BaUard, B. A "Domain Class" approach to transportable natural language processing. Cogn~tio~ g~td /Yrczin Theory, 5 (1982), 3, pp. 269-287. Ballard, B. and Lusth, J. An English-language...
- 5
- 452
- 0
Báo cáo khoa học:The isolation and characterization of temperature-dependent ricin A chain molecules in Saccharomyces cerevisiae docx
... ricin, in particular itsroute into target cells and the fate of its two subunits,RTA and the cell-binding galactose-specific lectin ricin toxin B chain (RTB), are essential to gain furtherinsights ... wereCP172 5Â-ATATTCCCCAAACAATACCC-3Â and the anti-sense primer CP133 5Â-TTAAAACTGTGACGATGGTGGA-3Â with the TAA termination anticodon shown in bold. Amplification reactions were performed in a final vol-ume ... doubly glycosylated RTA.Fig. 6. Stability of mutant ricin A chains. The kinetics of proteindegradation of (A) Kar2SP-RTAE177D and (B) Kar2SP-RTAF108L ⁄L151P at all temperatures, or a cytosolic...
- 14
- 411
- 0
Báo cáo khoa học: The Yin and Yang of protein folding doc
... general, fold to the native state ona sub-second timescale and have been the focus of many experimental and theoretical studies of folding [5]. The folding landscape of these proteins is usuallyrelatively ... Jahn and S. E. Radford The Yin and Yang of protein folding FEBS Journal 272 (2005) 59625970 ê 2005 The Authors Journal compilation ê 2005 FEBS 5967 folding energy landscape in the context of amyloidfibril ... formation of the prion protein. Proc Natl Acad Sci USA 101, 2293–2298.64 Dobson CM (2004) Experimental investigation of pro-tein folding and misfolding. Methods 34, 4–14. The Yin and Yang of protein...
- 9
- 460
- 0
Báo cáo khoa học: Cloning, expression and characterization of a family-74 xyloglucanase from Thermobifida fusca pptx
... 3087 Cloning, expression and characterization of a family-74 xyloglucanase from Thermobifida fusca Diana C. Irwin, Mark Cheng*, Bosong Xiang†, Jocelyn K. C. Rose‡ and David B. WilsonDepartment of ... equation.All reducing sugar assays included a glucose standardcurve. The average molecular mass of the XG oligosaccha-rides (XGOs) was calculated from the manufacturer’s data and was found ... using theT. fusca Cel 6A signal sequence (MRMSPRPLRALLGAAAAALVSAAALAFPSQAA) in place of its nativesignal sequence. Cel 6A, Cel6Acd, and Cel4 8A have beenexpressed and secreted successfully by...
- 9
- 453
- 0
Báo cáo khoa học: "The Acquisition and Application of Context Sensitive Grammar for English" docx
... The Acquisition and Application of Context Sensitive Grammar for English Robert F. Simmons and Yeong-Ho Yu @cs.texas.edu Abstract Department of Computer Sciences, AI Lab University of Texas, ... parsing and rapid acquisition of CSG from example parsings of newspaper stories. Chomsky[1957] defined a hierarchy of grammars in- cluding context- free and context- sensitive ones. For nat- ... sense and syntactic structure for otherwise ambiguous usages of lan- guage. An explicit use of context- sensitive grammar was de- veloped by Simmons and Yu [1990] to solve the prob- lem of accepting...
- 8
- 478
- 0
Báo cáo khoa học: "The detection and representation of ambiguities of intension and description" pptx
... Laboratory for Computer and Communications Research, Simon Fraser University, Burnaby, B.C., Canada. March 1985. 199 The detection and representation of ambiguities of intension and description ... that since the filler of the role Queen of England is not likely to change within the time of the conversation and the speaker, the hearer, and Nadia are all aware of who fills that role, ... following order: the intensionality of the descrip- tor, the time of reference of the descriptor, and the agents of the descriptor. We must establish the "level" of each factor in...
- 8
- 304
- 0
Báo cáo khoa học: "The expression and localization of inhibin isotypes in mouse testis during postnatal development" pdf
... pattern of the inhibin isotypes α, βA and βB during the postnatal development of mouse testis The protein levels of the inhibin α, βA and βB isotypes in the testes during postnatal ... the expression of inhibin isotypes. Hence, inhibin regulates the development of Sertoli cells and spermatogenesis in mouse testis. In this study, inhibin α immunoreactivity was detected mainly ... μm. expression of inhibin isotypes might be observed in seminiferous tubules in mice during testicular development. This study examined the level and cellular localization of inhibin isotypes, ...
- 5
- 283
- 0
báo cáo khoa học: "The expression and role of protein kinase C (PKC) epsilon in clear cell renal cell carcinoma" ppt
... expression and role of protein kinase C (PKC) epsilon in clear cell renal cell carcinoma. Journal of Experimental & Clinical Cancer Research 2011 30:88.Submit your next manuscript to BioMed Central and ... 0.002G3/G422 2 20PKCε, protein kinase C epsilon. Figure 2 Expression of PKCε in renal cell carcinoma (RCC) cell lines. A. Western blot shows that PKCε is expressed in all five RCC cell lines, with the ... Experimental & Clinical Cancer Research 2011, 30:88http://www.jeccr.com/content/30/1/88Page 5 of 9 crucial for survival of clear cell RCC cells and may serveas a therapeutic target of RCC.MethodsSamplesWe...
- 9
- 308
- 0
báo cáo khoa học: " The acceptability and feasibility of peer worker support role in community based HCV treatment for injecting drug users" pot
... the peer worker role fit in with the rest of the Healthy Liver Clinic team? The positioning of the peer worker role within the rest of the HLC team produced some interesting points of discus-sion. ... Given the intimate involvement of the peer worker in the clinic, the evaluation was designed in conjunctionwith the peer worker and thus these efforts should be rec-ognised. The peer worker ... number not for citation purposes)Harm Reduction JournalOpen AccessResearch The acceptability and feasibility of peer worker support role in community based HCV treatment for injecting drug usersJosephine...
- 9
- 303
- 0
Từ khóa: chuyên đề điện xoay chiều theo dạngNghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiMột số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitNGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDEPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọPhát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ longPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Thiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khíKiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtChiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015HIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀMMÔN TRUYỀN THÔNG MARKETING TÍCH HỢPTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ