Báo cáo khoa học: "An assessment of edge effect on growth and timber external quality of ayous (Triplochiton scleroxylon K Schum) under Cameroon rain forest conditions" docx

... of edge effect on growth and timber external quality of ayous (Triplochiton scleroxylon K Schum) under Cameroon rain forest conditionsTB MayakaJN FonwebanZ TchanouP Lontchui1 ... An investigation was conducted in order to assess the edge effect on growth characteristics and timber external quality of ayous (Triplochiton scleroxylon K, Schum). Average ... competition and mobility of fertilizer.It is also commonplace in silviculture for edge trees to exhibit a different pattern of growth and conformation (lack of straight-ness of...

Báo cáo khoa học: Betulinic acid-mediated inhibitory effect on hepatitis B virus by suppression of manganese superoxide dismutase expression pot

... cAMP-response element-binding protein-bindingmotif on the SOD2 promoter. SOD2 overexpression abolished the inhibi-tory effect of BetA on HBV replication, whereas SOD2 knockdown mim-icked this effect, ... combination of BetA and SOD2 overexpression totally abolished the BetA-mediated HBV-inhibitory effect. On the other hand,SOD2 knockdown (siSOD2) mimicked the BetA-induced inhibitory effect. ... HBx alone does not directly contribute to BetA-induced SOD2 suppression and HBV inhibition,whereas HBx translocation to mitochondria could be aconsequence of BetA-induced SOD2 suppression and subsequent...

Báo cáo khoa học: "AN ASSESSMENT EXTRACTED OF SEMANTIC INFORMATION FROM MACHINE READABLE AUTOMATICALLY DICTIONARIES" pptx

... result of a lack of distinction among terms and the lack of a one-to-one mapping between terms and concepts, especially at the highest levels of the hierarchy. 3.1. Incomplete information The ... systematically, and those that have done so have been restricted to consideration of the quality of grammatical information (e.g., Akkerman, Masereeuw, and Meijs, 1985). No evaluation of automatically ... any one of the d~tionaries alone. 5. CONCLUSION The results of our study show that dictionaries can be a reliable source of automatically extracted semantic information. Merging information...

Tài liệu Báo cáo khoa học: An allosteric DNAzyme with dual RNA-cleaving and DNA-cleaving activities doc

... substrate and RNase A, we constructed asimple conformational switch to control the DNA-cleaving activity of DRc DNAzyme. The generation of a new active site within a DNAzyme scaffold and reg-ulation ... being reached at 100 lm. The rate of DNA cleavagewas highly dependent on the concentration of Cu2+used in the reaction mixture. When the concentration of Cu2+was higher or lower than 100 ... 20%denaturing PAGE and visualized by autoradiography.Regulation of the DNA cleavage of the DNAzymeFor ‘negative’ regulation assays, reactions were initiated bythe addition of a mixture of 1 nm 5¢-32P-labeled...

Tài liệu Báo cáo khoa học: "An Open Source Toolkit for Phrase-based and Syntax-based Machine Translation" docx

... Decoder, Alignment, and Learning Framework for Finite-State and Context-Free Translation Models. In Proc. of ACL 2010 System Demonstrations, pages 7-12. Jason Eisner. 2003. Learning non-isomorphic ... Galley, Jonathan Graehl, Kevin Knight, Daniel Marcu, Steve DeNeefe, Wei Wang and Ignacio Thayer. 2006. Scalable inferences and training of context-rich syntax translation models. In Proc. of COLING/ACL ... for machine translation. In Proc. of ACL 2003, pages 205-208. Michel Galley, Mark Hopkins, Kevin Knight and Daniel Marcu. 2004. What's in a translation rule? In Proc. of HLT-NAACL 2004,...

Tài liệu Báo cáo khoa học: "An Unsupervised Model for Joint Phrase Alignment and Extraction" ppt

... 49. 8k 49. 8k 49. 8k 68. 9k Tune (other) 47. 2k 52. 6k 55. 4k 80. 4k Test (en) 65. 6k 65. 6k 65. 6k 40. 4k Test (other) 62. 7k 68. 1k 72. 6k 48. 7k Table 1: The number of words in each corpus for TM and LM training, ... Utiyama, Mikio Yamamoto, and Takehito Utsuro. 2008. Overview of the patent trans-lation task at the NTCIR-7 workshop. In Proceedings of the 7th NTCIR Workshop Meeting on Evaluation of Information Access ... Sumita2, Shinsuke Mori1, Tatsuya Kawahara11Graduate School of Informatics, Kyoto UniversityYoshida Honmachi, Sakyo-ku, Kyoto, Japan2National Institute of Information and Communication Technology3-5...

Báo cáo khoa học: "An Architecture for Dialogue Management, Context Tracking, and Pragmatic Adaptation in Spoken Dialogue Systems" pot

... referents) Back-end command Pragmatic Adaptation on Output Context Tracking on Output Dialogue Manager Convert back-end response to logical form representation of communicative act Track discourse ... contribution of this work is thus in the generic definition of standard dialogue func- tions such as dynamic troubleshooting (repair), context updating, anaphora resolution, and translation ... repair dialogues, and how often to back- channel. 1.2 Context Tracking The Context Tracker maintains a record of the discourse context which it and other components can consult in order to...

Báo cáo khoa học nông nghiệp " CLOSER LINKS BETWEEN RESEARCH, PRODUCTION AND MARKET TO ASSURANCE OF SAFETY AND HIGH QUALITY VEGETABLES FOR CONSUMERS " potx

... 100 kg/ha P2O5 and 50kg/ha of K 2O. IPM resulted in adequate control of insects. GAP production pilots: At the same time of trials at ASINCV, production demonstrations were carried out on ... 4. Kawakami, T., T. T. Khai, et al. (1999). "Development and practice of the participatory programme on improving working and living conditions in rural communities in the Mekong delta ... Some Components of the Plan: INTEGRATED PRODUCTION AND MARKETING PLAN PRODUCTION DISTRIBUTION SALES & MARKETING Product Specifications Packaging Sales Coordination Production Systems...

Báo cáo khoa học: "The Corpora Management System Based on Java and Oracle Technologies" potx

... annota-tion and corpora manipulation procedures.Reusability of linguistic and corpora manipulationbusiness services could be achieved by usage of awidely accepted set of UML notation standards ... HTML, and Oracle9i components(Yablonsky S.A., 2002). The system was by adapt-ing existing and new DBMS and Java tools to thenecessities of the intended task for the Russianlanguage (Yablonsky ... 0_ FKRUBRICS NO = RUBRICS_NOREF ADV 3ERDOD S_NO = DOD S_NOFigure 2. Fragment of UML notation of data modelUML specification of business services uses stan-dard UML notations of standard...

Tài liệu Báo cáo khoa học: An alternative isomerohydrolase in the retinal Muller cells of a cone-dominant species doc

... | | |ETIKQVDLCNYVSVNGATAHPHIENDGTVYNIGNCFGKNFSIAYNIVKIPPLQADKEDPISKSEIVVQFPCSDRFKPSYV L .K M NI V R M GA.L R T .K S E KV SAE V .K L L A M.L EE.S LAM.KVL S.E V .K L L A M.L E S.QFE K. L S.E ... 11cRAL tocone photoreceptors in cone-dominant species. Identiﬁcation of an alterna-tive visual cycle will contribute to the understanding of the functional differ-ences of rod and cone photoreceptors.Structured ... Journal compilation ª 2011 FEBS 2925blank HPLC proﬁle (background) was obtained using pro-teins without substrate under the same reaction conditions and extraction procedures. The peak of each retinoid...

Xem thêm

Từ khóa: Nghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt nam đề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giải Biện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọ Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Phối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọ Phát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninh Phát hiện xâm nhập dựa trên thuật toán k means Định tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tin Thiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khí Sở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIX Tổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vật Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vật Nguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Trách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)HIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀM