0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Báo cáo khoa học: " Livelihood Strtategies of Peri-Urban Households in Response to Rural Urban Linkages: A Case Study in a Peri-Urban Area of Hanoi, Vietnam" ppt

Báo cáo khoa học:

Báo cáo khoa học: " Livelihood Strtategies of Peri-Urban Households in Response to Rural Urban Linkages: A Case Study in a Peri-Urban Area of Hanoi, Vietnam" ppt

... Journal of Science and Development April 2008: 17-30 HANOI UNIVERSITY OF AGRICULTURE Livelihood Strtategies of Peri -Urban Households in Response to Rural - Urban Linkages: A Case Study in a Peri -Urban ... livelihood assets including natural capital, human capital, physical capital, financial capital and social capital. Those households who have more livelihood assets tend to take more advantage of ... rural areas to inner Hanoi. The migrants are involved in a myriad of economic activities. Moreover, the increasingly integrating role of the non-state market has helped link rural and urban...
  • 14
  • 405
  • 0
Tài liệu Báo cáo khoa học: High affinity copper binding by stefin B (cystatin B) and its role in the inhibition of amyloid fibrillation docx

Tài liệu Báo cáo khoa học: High affinity copper binding by stefin B (cystatin B) and its role in the inhibition of amyloid fibrillation docx

... and Manca Kenig forcloning and isolating the recombinant proteins. Wealso are grateful to Sabina Rabzelj and Sasˇ a JenkoKokalj for performing certain SEC experiments andfor activity measurements. ... domain is cap-able of domain swapping and forms a dimer as revealedby crystal structure analysis [36]. In our case, SEC datacollected for samples at pH 7 have confirmed that cop-per binding ... aggregation and amyloid fibril forma-tion of a pathological mutant (in inherited diseases), or of a normal protein or its normal variant (in sporadiccases). Amyloid fibril formation is regarded as a genericproperty,...
  • 14
  • 586
  • 0
Báo cáo khoa học: The signature amidase from Sulfolobus solfataricus belongs to the CX3C subgroup of enzymes cleaving both amides and nitriles Ser195 and Cys145 are predicted to be the active site nucleophiles pot

Báo cáo khoa học: The signature amidase from Sulfolobus solfataricus belongs to the CX3C subgroup of enzymes cleaving both amides and nitriles Ser195 and Cys145 are predicted to be the active site nucleophiles pot

... 177 A AO55930 PSEDATVVKRLLAAGATVVGKSVCEDLCFSGASFTSASGAVKNPWDLARNAGGSSSGSAV 177 ZP_00124054 PSEDATVVKRLLAAGATVIGKSVCEDLCFSGASFTSATGAVKNPWDLTRNAGGSSSGSAV 177 BAC99079 PSRDATVVTRLLAAGATVAGKAVCEDLCFSGSSFTPASGPVRNPWDPQREAGGSSGGSAA ... water-bondedintermediate. In contrast, serine and thiol protease andamidase are confined to interacting with planar sub-strates and tetrahedral intermediates [2].Our comparative model suggests that the two cata-lytic ... recombinant SsAH-WT remainsactive at 70 °C for about 6 days and has a half-life of 5 h at 95 °C (data not shown).We found that SsAH-WT is able to convert bothamides and nitriles, and in particular...
  • 9
  • 478
  • 0
Báo cáo khoa học: Light-harvesting complex II protein CP29 binds to photosystem I of Chlamydomonas reinhardtii under State 2 conditions doc

Báo cáo khoa học: Light-harvesting complex II protein CP29 binds to photosystem I of Chlamydomonas reinhardtii under State 2 conditions doc

... novo, gaining initial two-dimensional class averages and then iterative refinement fol-lowed in order to obtain improved class averages. Standardmolecular modelling programs were used to visualize ... reinhardtii light-harvesting proteins.Eukaryot Cell 2, 978–994.26 Tokutsu R, Teramoto H, Takahashi Y, Ono TA &Minagawa J (2004) The light-harvesting complex of photosystem I in Chlamydomonas ... Conversely, in PSI-favouring light, oxidation of plastoquinone occurs,leading to deactivation of LHCII-specific kinases anddephosphorylation of mobile LHCII by redox-inde-pendent phosphatases. As a consequence,...
  • 10
  • 318
  • 0
Báo cáo khoa học: Chronic high-dose morphine treatment promotes SH-SY5Y cell apoptosis via c-Jun N-terminal kinase-mediated activation of mitochondria-dependent pathway pdf

Báo cáo khoa học: Chronic high-dose morphine treatment promotes SH-SY5Y cell apoptosis via c-Jun N-terminal kinase-mediated activation of mitochondria-dependent pathway pdf

... cytochrome c release and caspase-3activation.SP600125, small interfering RNA (siRNA) againstJNK and NAC attenuated morphine-inducedapoptosisAccumulating evidence shows that activation of ... purchased from QinghaiPharmaceutical General Factory (Qinghai, China). SRB,DCFH2-DA, naloxone, HE, NAC, ALP, DPI, CsA, theannexin V–FITC ⁄ PI apoptosis detection kit and antibodyagainst b -actin ... regulators of mito-chondrial integrity and mitochondria-initiated cyto-chrome c release and caspase activation. The Bcl-2family includes antiapoptotic members such as Bcl-2and Bcl-XL, and proapoptotic...
  • 15
  • 244
  • 0
Báo cáo khoa học: Lipid droplet and milk lipid globule membrane associated placental protein 17b (PP17b) is involved in apoptotic and differentiation processes of human epithelial cervical carcinoma cells pptx

Báo cáo khoa học: Lipid droplet and milk lipid globule membrane associated placental protein 17b (PP17b) is involved in apoptotic and differentiation processes of human epithelial cervical carcinoma cells pptx

... carcinomas. HeLacells and human milk are stained with anti-PP17 antibody. (A) In invasive squamous cervical carcinoma, tumour cells have punctuated,ring-like cytoplasmic PP17 staining (immunohistochemistry, ... haema-toxylin counterstain). (B) Lipid-loaded HeLa cells have dominantlygranular PP17 staining (immunocytochemistry, haematoxylin count-erstain). (C) Compared to controls (D) in lipid-loaded ... myogenic factor, MYO-D [48]; (g)keratinocyte specific factors, AP-2, GCF and PAX-2 [49];(h) factors abundant in placenta, AHR [50], AP-2 andPPARc; (i) proliferation and/or apoptosis regulators, AP-2,c-MYC...
  • 13
  • 371
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "Self-Organizing Markov Models and Their Application to Part-of-Speech Tagging" potx

... are practical prob-lems we face when we try to apply the algorithms to language learning problems. One of the main obsta-cles is the fact that features used for language learn-ing often have ... Estimated Performance of Various Modelsman readable and we are planning to develop editingtools for self-organizing Markov models that helpexperts to put human knowledge about language intothe ... Statistical Part -of- Speech Tag-ger. In 6’th Applied Natural Language Processing.H. Sch¨utze and Y. Singer. 1994. Part -of- speech taggingusing a variable memory Markov model. In Proceed-ings...
  • 7
  • 400
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "Physical damage on tropical tree saplings: quantification and consequences for competition through height growth in a neotropical rain forest of French Guiana" pdf

... Physical damage isthe mechanical breakage of a stem by ananimal (due to tramping, scraping, push-ing, biting or boring for example) or bymaterial falling from a higher ... ecologicaltemperment of a species influence thefrequency of damage to saplings?2) For a given individual of a givenspecies, is physical damage automaticallydetrimental in ... pioneerspecies such as Cecropia spp. orSimaropuba amara Aubl. [9]. Overall,Goupia glabra was found here to growmuch faster than Pradosia cochlearia andBocoa prouacensis. Moreover,...
  • 16
  • 260
  • 0
Tài liệu Báo cáo khoa học: The heat shock factor family and adaptation to proteotoxic stress pdf

Tài liệu Báo cáo khoa học: The heat shock factor family and adaptation to proteotoxic stress pdf

... Nakamura T, Takaki E,Hayashida N, Hai T & Nakai A (2007) Heat shocktranscription factor 1 opens chromatin structure of interleukin-6 promoter to facilitate binding of anactivator or a ... reagents,17-allylamino-17-demethoxygeldanamycin (17-AAG) andgeranylgeranylacetone (GGA), also ameliorated diseaseprogression in a Drosophila model of spinocerebellarataxias [101] or in a mouse model of ... Waza M, Adachi H, Katsuno M, Minamiyama M,Sang C, Tanaka F, Inukai A, Doyu M & Sobue G(2005) 17-AAG, an Hsp90 inhibitor, amelioratespolyglutamine-mediated motor neuron degeneration.Nat...
  • 14
  • 687
  • 0
Tài liệu Báo cáo khoa học: Mouse recombinant protein C variants with enhanced membrane affinity and hyper-anticoagulant activity in mouse plasma pptx

Tài liệu Báo cáo khoa học: Mouse recombinant protein C variants with enhanced membrane affinity and hyper-anticoagulant activity in mouse plasma pptx

... variants withimproved membrane binding characteristics and hyper-anticoagulant activity. Binding ability was establishedusing a SPR membrane binding assay and anticoagu-lant activity was assessed ... end point assay, the anticoagulantpotency of human APC variant QGNSEDY in humanplasma parallels that of mouse APC mutant III in mouse plasma. Mutant III, although only containingfive mutations, ... silver staining. Protein C vari-ants and molecular weight markers (MWM) ran in each lane areindicated. The location of heavy chain (HC), light chain (LC) andthrombin (IIa) is also indicated.Anticoagulant...
  • 17
  • 495
  • 0

Xem thêm

Từ khóa: báo cáo khoa học mẫubáo cáo khoa học y họcbáo cáo khoa học sinh họcbáo cáo khoa học nông nghiệpbáo cáo khoa học lâm nghiệpbáo cáo khoa học thủy sảnMột số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngTìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinSở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXChuong 2 nhận dạng rui roTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)HIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀMTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ