Báo cáo toán học: "Chemical composition and antibacterial activity of the essential oils from Launaea resedifolia L " docx
Báo cáo khoa học: Improving thermostability and catalytic activity of pyranose 2-oxidase from Trametes multicolor by rational and semi-rational design pdf
... lL of the cellsuspension of each well were transferred into another96-well plate containing 200 lLof2· LBamp⁄ lactose (yeastextract 10 g L )1, peptone from casein 20 g L )1, sodiumchloride ... resulting from the oxida-tion of the sugar, at the active site of the enzyme and transfer these to the electrode. In a biofuel cell basedon an enzyme that is electrically wired to the electrodein ... Met541 and Leu545 are then completelyexposed to the solvent of the internal void, and distant from the aromatic side chain of Tyr456 in the substrate loop.When replacing Glu542 by Lys, the Glu542-Ser153hydrogen...
- 17
- 438
- 0
Tài liệu Báo cáo khoa học: Helix mobility and recognition function of the rat thyroid transcription factor 1 homeodomain – hints from 15N-NMR relaxation studies pdf
... RSDM calculation. The homogeneity of the values of the overall correlation time calculated from the individual (R2⁄ R1) ratiossuggested a good degree of isotropy of the global molecular motion, ... J(<xH>), directly calculated from the measured relaxation parameters, that contain contribu-tions from the overall as well as the local dynamics.Graphical analysis of the spectral density values pro-vides ... helix.Global overall and generalized internalcorrelation times The roots of the third-order polynomial proposed byLefe`vre [21] were calculated for both linear correla-tions of J(xN) and...
- 14
- 744
- 0
Tài liệu Báo cáo khoa học: Molecular modeling and functional characterization of the monomeric primase–polymerase domain from the Sulfolobus solfataricus plasmid pIT3 doc
... plasmid pRN1[13] reveal that the novel fold in the N-terminal mod-ules of the catalytic cores of AEPs and prim–pols isunrelated to that of other known polymerases, whereas the RRM-like fold ... both these primases and the associated heli-cases are the constituent elements of the replicationinitiation complex of the corresponding plasmids [12].Available structural data on the small primase ... both the relatedRepA of crenarchaeal plasmids and the ORF904 pro-tein of the plasmid pRN1, which is the only enzymebiochemically characterized to date in Sulfolobalesplasmids. Despite low...
- 14
- 620
- 0
Tài liệu Báo cáo khoa học: Design, structure and biological activity of b-turn peptides of CD2 protein for inhibition of T-cell adhesion ppt
... adhesion and costimulation in the normalimmune response. The CD2 molecule is a transmembraneglycoprotein expressed on all subsets of T-cells, NK cells and lymphokine-activated killer cells, all known ... (2000) Linear and cyclic LFA-1 and ICAM-1 pep-tides inhibit T cell adhesion and function. Peptides 21, 1161–1167.Supplementary material The following material is available from http://blackwellpublishing.com/products/journals/suppmat/ejb/ejb4198/ejb4198.htmAppendix ... 12-mer linear and cyclicpeptides (lVY, cVY, lER, and cER) as well as cyclichexapeptides (cEL a nd cYT) that were derived from the ratCD2 sequence. Initially, the design of small molecularinhibitors...
- 14
- 657
- 0
Tài liệu Báo cáo khoa học: Molecular characterization and allergenic activity of Lyc e 2 (b-fructofuranosidase), a glycosylated allergen of tomato pdf
... structures. The structures of the N-glycans of nLyc e 2 and their molecular percentagesare presentec in Table 2. The peptide analysis of nLyc e 2 identified 21 peptides of the natural allergen. One of ... identify and characterize tomato allergens. In most reports, allergy totomato is linked to other allergies such as grass pollen [1] and latex allergy [2,3]. The prevalence of tomato allergyranges from ... 1 from cypress pollen [10], Ara h 1 from peanut [11] as well asa vicilin-like protein from hazelnut [12]. The analysis of free [13] and linked [14] N-glycans of tomato revealed the presence of...
- 11
- 533
- 0
Tài liệu Báo cáo khoa học: Physicochemical characterization and biological activity of a glycoglycerolipid from Mycoplasma fermentans ppt
... potential involvement of TLR2 and TLR4 in the recognition and signal transduction of the glycolipids, we analyzed the stimulatory activity of MfGl-IIin a CHO cell reporter system. Upon the induction ... on the property of lysates of amebocytes of the horseshoe crab Limulus polyphemus,toform a solid gel in the presence of minute amounts of endotoxins. The comparison of LPS and MfGl-II in the LAL ... indicating the existence of unilamellar vesicles as well asa nonlamellar cubic structure, as also the latter leads to anisotropic signal [46]. Therefore, a differentiation betweenunilamellar and...
- 9
- 665
- 1
Báo cáo khoa học: Purification and structural analysis of the novel glycoprotein allergen Cyn d 24, a pathogenesis-related protein PR-1, from Bermuda grass pollen pot
... STQLPSDEPLNGLNDKAIQDILNEHNMFRAKEHVPPLTWNTTLA 44 Hordeum MQTPKLVILLALAMSAAMVNLSQAQNSP YVSP AA AVG.GAVS.S.K.Q 54 Triticum MQTPKLAILLALAMSAAMANLSQAQNSP Y.SP AA AVG.GAV S.K.Q 54 Zea MAPRLACLLALAMAAIVVAPCTAQNSP ... Characterization of the isoforms of the groupI allergen of Cynodon dactylon. J Allergy Clin Immunol95, 1206–1214.8 Smith PM, Sulphilglu C, Griffith IJ, Theriault K, KnoxRB & Singh MB (1996) Cloning and ... [13]. Of the plant allergens listed in the of cial allergendatabase of the IUIS, about 25% belong to variouspathogenesis-related protein groups and these have beencategorized into nine of the...
- 10
- 665
- 0
Báo cáo khoa học: Purification and structural study of the b form of human cAMP-dependent protein kinase inhibitor pdf
... & Walsh, D.A. (1997) Specific tes-ticular cellular localization and hormonal regulation of the PKI and PKI isoforms of the inhibitor protein of the cAMP-dependentprotein kinase. J. Biol. Chem. ... the cells; C, 5 lLofheat-treated crude extract; D, 5 lLof(NH4)2SO4fractionation; E, 5 lLofDEAEeluate;F,10lL of DEAE eluate. Fractions were analyzed bySDS/PAGE (12%) followed by staining ... 2. Electrophoresis analysis of proteins present in fractions from bacterial cultures containing human PKIb expression vectors. A, 2.5 lL of markers; B, 5 lL of the crude extract from the cells;...
- 6
- 531
- 0
Báo cáo khoa học: Solution structure and backbone dynamics of the XPC-binding domain of the human DNA repair protein hHR23B docx
... Because of the known dependence of the overall correlation time scon the molecular size of various proteins [23], both scvalues of the XPCB arewell matched to those of spherical molecules of ... functional domain. A number of other cellular proteins exist that, like hHR23B, con-tain the STI1, UBL and UBA domains connected byrelatively flexible linkers. It is likely that the STI1domains of these ... retain the original values obtained from the auto-assignment and the structure calculation using cyanawhen the distance violations were relatively small. Among the 30 structures with the lowest...
- 10
- 431
- 0
Báo cáo khoa học: Molecular cloning and functional expression of the human sodium channel b1B subunit, a novel splicing variant of the b1 subunit potx
... tissues. (A) The presence of b1Bin Purkinje cells (large arrowheads) and intheir processes (small arrowheads) of the cerebellum. (B) Specific b1Blabeling was abolished in the Purkinje cells (arrowhead) ... placenta, lung, liver, kidney and pancreas. Inhuman brain, the b1Btranscript was most abundant in the cerebellum, followed by the cerebral cortex and occipitallobe (Fig. 2B). The overall ... able to modulatealmost all aspects of the channel properties, includingvoltage dependent gating, activation and inactivation, aswell as greatly increasing the number of functional channelspresent...
- 9
- 415
- 0
Từ khóa: các báo cáo toán học haybáo cáo toán học hayglobal input of chemical elements and pollution status of the baltic seachemical biochemical and microbiological phenomena of the medicinal and aromatic plants extract used in the preparation of tassabount date juice in moroccohow to use the pesticide and chemical tables and guides each of the pesticides listed in table 1 isc tepe b daferera d polissiou m harmandar m 2008 studies on the antioxidant activity of the essential oil and methanol extract of marrubium globosum subsp globosum lamiaceae by three different chemical assays bioresour technol 99 10 pp 4239 46prakash and b ragavan 2009 phytochemical observation and antibacterial activity of cyperus esculentus l anc sci life vol 28 4 16 20antibacterial inhibitors of the essential cell division protein ftszantibacterial activity of naturally occurring compounds from selected plants2014 quot total antioxidant activity and antimicrobial potency of the essential oil and oleoresin of zingiber officinale roscoe quot asian pacific journal of tropical disease 4 1 pp 40 44báo cáo khoa học toán họcngô bảo châu amp đỉnh cao toán họcbáo cáo môn học mật mã và an toàn dữ liệubáo cáo khoa học hội nghị công nghệ sinh học toàn quốc hà nội 1999nguyễn bá đức 2006 tổng quan về tình hình ung thư và công tác phòng chống ở việt nam báo cáo toàn văn hội nghị khoa học toàn quốc trang 6 26chuyên đề điện xoay chiều theo dạngNghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọNghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùngTìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinThiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khíSở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXChuong 2 nhận dạng rui roTranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)Chiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015Đổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ