báo cáo hóa học:" Characteristics of non-AIDS-defining malig

Báo cáo hóa học: " Overexpression of microRNA-206 in the skeletal muscle from myotonic dystrophy type 1 patients" docx

... Utrophin was taken from Arning et al. [29] (Forward 5' aaggacctggtcaacgttcca 3', Reverse 5' acccgtgtcatagacattgagca 3'). The Beta-Actin mRNA level was used as control for normalization ... normalization of samples (For- ward 5#8242; gacaggatgcagaaggagattact 3', Reverse 5#8242; tgatccacatctgctggaaggt 3'). Nothern Blot analysis Given the limited amount of R...

Ngày tải lên : 18/06/2014, 16:20

9
444
0

báo cáo hóa học: " Efficacy of motor imagery in post-stroke rehabilitation: a systematic review" ppt

... pre- sented data of three studies in a quantitative manner with forest plots of the ARAT and the FMSA to facilitate the interpretation of the effects of MI. For further research, the authors recommend ... effec- tive than MI or functional training alone [18]. However, Sharma [12] has pointed out that MI training alone pro- duces less improvement than functional training....

Ngày tải lên : 19/06/2014, 10:20

10
359
0

báo cáo hóa học: " Use of alcohol and drugs by Norwegian employees: a pilot study using questionnaires and analysis of oral fluid" doc

... participated in designing the study and interpreting the data. BY had the main responsibility for planning and coordinating the acquisition of data. HG had the main responsibility for drafting ... detected as a metabolite of methamphetamine. The combination of methamphetamine and sedatives may indicate chronic addictive methamphetamine use. The detection time frame for...

Ngày tải lên : 20/06/2014, 00:20

8
418
0

báo cáo hóa học:" Multiple synchronous primary malignancies induced by benzene exposure: a case report" docx

... T, Nakashima K, Isozaki H, Takakura N, Tanaka N: Multiple hepatic adenomas caused by long-term administration of andro- genic steroids for aplastic anemia in association with familial adenomatous ... Schreiner CA, Mehlman MA, Mackerer CR: 32P analysis of DNA adducts in tissues of benzene-treated rats. Environ Health Perspect 1989, 82:253-257. 14. Nakao A, Sakagami K, Nakata Y, Koma...

Ngày tải lên : 20/06/2014, 00:20

4
274
0

Báo cáo hóa học: " Contribution of cysteine residues in the extracellular domain of the F protein of human respiratory syncytial virus to its function" docx

... RRRRFAGVVIGLAALGVATAAQVTAAVALVKANENAAAILNLKNAIQKTNAAVADVVQATQSLGTAVQAVQDHINSVVSPAITAANCKAQDAIIGSILNLY Measles SSRRHKRFAGVVLAGAALGVATAAQITAGIALHQSMLNSQAIDNLRASLETTNQAIEAIRQAGQEMILAVQGVQDYINNELIPSMNQLSCDLIGQKLGLKLLRY ... RHKRFAGIAIGIAALGVATAAQVTAAVSLVQAQTNARAIAAMKNSIQATNRAVFEVKEGTQRLAIAVQAIQDHINTIMNTQLNNMSCQILDNQLATSLGLY NDV GRQGRLIGAIIGGVALGVATAAQITAAAALIQAKQNAANILRLKESIAATNEAVHEVTDGLSQLAVAV...

Ngày tải lên : 20/06/2014, 01:20

11
343
0

$báo cáo hóa học:" Augmentation of tibial plateau fractures with Trabecular Metal™: a biomechanical study" pdf$

báo cáo hóa học:" Augmentation of tibial plateau fractures with Trabecular Metal™: a biomechanical study" pdf

... Abstract Background: Restoration and maintenance of the plateau surface are the key points in the treatment of tibial plateau fractures. Any deformity of the articular surface jeopardizes the ... lateral tibial plateau fracture and the absence of soft tissues also facilitated the optimal place- ment of the implants. Furthermore, bony ingrowth is a critical facto...

Ngày tải lên : 20/06/2014, 04:20

6
302
0

báo cáo hóa học: " Diagnosis of invasive candidiasis in the ICU" pot

... Kontoyiannis D, Jiang Y, Raad I: The changing epidemiology of invasive candidiasis: candida glabrata and Candida krusei as the leading causes of candidemia in hematologic malignancy. Cancer 2008, ... Leon C, Ruiz-Santana S, Saavedra P, Galvan B, Blanco A, Castro C, et al: Usefulness of the “Candida score” for discriminating between Candida colonization and invasive candidiasis...

Ngày tải lên : 21/06/2014, 00:20

10
669
0

báo cáo hóa học:" Effect of TiO2 nanoparticles in the earthworm reproduction test" pot

... material has lead sponsors that organize the testing and the preparation of a Dossier containing the results, which describe the fate and effect of nanomaterials and the preparation of guidance ... than the variation in the number of offspring during the year, indicating that the fluctuation in the absolute number of juveniles cannot be explained by biol...

Ngày tải lên : 21/06/2014, 17:20

17
363
0

Báo cáo hóa học: "Effect of TiO2 nanoparticles in the earthworm reproduction test" docx

... describe the fate and effect of nanomaterials and the preparation of guidance documents for testing and evaluation. A preliminary review on the application of OECD guidelines to manufactured nanomaterials ... than the variation in the number of offspring during the year, indicating that the fluctuation in the absolute number of juveniles cannot be explained...

Ngày tải lên : 21/06/2014, 19:20

17
410
0

báo cáo hóa học:" Finger joint motion generated by individual extrinsic muscles: A cadaveric study" doc

... either the middle or the distal phalanx. The FDP spans the MCP, PIP, and DIP joints, inserting at the base of distal phalanx, and the FDS spans the MCP and PIP joint, inserting at the middle phalanx. ... motion among the metacarpophalangeal (MCP), proximal interphalangeal (PIP) and distal interphalangeal (DIP) joints [1,2]. A combined activation of the FDP and FDS...

Ngày tải lên : 20/06/2014, 01:20

7
194
0

báo cáo hóa học:" Characteristics of non-AIDS-defining malignancies in the HAART era: a clinico-epidemiological study" doc