Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf

... Novel glycogen-targeting subunit of PP1 A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents Shonagh ... ATC CAC TTT ATC TGA gacgaggcgcctgcggccgacggcggaaaacaccaaaggcacccgggggcggggcgacccgatgtggcggggaggagtag 920276 I H F I * 279 9 21 gagagaccaggattggcgggagcggtccaagggagtc 957Fig. 1. (A) Diagram of ... QLQRDALRHFAPCPPRTRGLQDARIALEPALEPGFAARLQAQRICLERADAGPLGVAGSHUMAN R3E 11 9 QLQRDALRHFAPCQPRARGLQEARAALEPASEPGFAARLLTQRICLERAEAGPLGVAGSMOUSE R3E 17 8 ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPSPPRADRFAFRLPAPPVGGTLLFRAT...

... (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primersfor unmethylated DNA were: 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCTACTT-3¢ (antisense).Caspase 3 activityCells ... (OccWT) and variant occludin in apoptosis and invasion, as determined by assay, werevealed that exon 9 played a major role in the induc-tion of mitochondria-mediated apoptosis and thereduction of ... is inactivated by increased expression of this protein in HeLa cells [12 ]. Our data showed that OccWTactivated only ERK1 ⁄ 2 and not p38 and JNK.On the basis of our data, exon 9 of occludin...

... preferentially expressed in brain.Biochim Biophys Acta 13 50, 11 14 . 11 Ogawa K, Yamada T, Tsujioka Y, Taguchi J, Takaha-shi M, Tsuboi Y, Fujino Y, Nakajima M, YamamotoT, Akatsu H, Mitsui S & Yamaguchi ... hippostasin ⁄ KLK 11 is up -regulated in ovarian and prostate cancers [17 ]. Recent experimental datasuggest that human kallikreins promote or inhibittumor growth, angiogenesis, invasion, metastasis ... 54, 419 –426. 12 Mitsui S, Tsuruoka N, Yamashiro K, Nakazato H &Yamaguchi N (19 99) A novel form of human neuropsin, a brain-related serine protease, is generated by alterna-tive splicing and is expressed...

... six-transmembrane domain structure of presenilin 1. J Biol Chem 272, 12 047 12 0 51. 24 Nakai T, Yamasaki A, Sakaguchi M, Kosaka K, Miha-ra K, Amaya Y & Miura S (19 99) Membrane topology of Alzheimer’s ... ER-retention, nicastrin-binding and gamma-secretase activity. Embo J 23, 4738–4748. 14 Tomita T, Takikawa R, Koyama A, Morohashi Y,Takasugi N, Saido TC, Maruyama K & Iwatsubo T (19 99) C terminus of presenilin ... for aneight-transmembrane-domain topology for Caenorhabdi-tis elegans and human presenilins. Proc Natl Acad SciUSA 95, 710 9– 711 4.23 Lehmann S, Chiesa R & Harris DA (19 97) Evidence fora...

... *Agtcgcccttctcagcgttccatcgatgcacacctgctatcgtggaacagcctagaaaccaagggactccaccaccaagtcacttcccctgctcgtgcagaggcacgggatgagtctgggtgacctctgcgccatgcgtgcgagacacgtgtgcgtttactgttatgtcggtcatatgtctgtacgtgtcgtgggccaacctcgttctgcctccagctttcctggttagcgcaacgcggctccacgaccacacgcacttcagggtggaagctggaagctgagacacaggttaggtggcgcgaggctgccctgcgctccgctttgctttgggattaatttattctgcatctgctgagaggggcaccccagccatatcttacactttggtaaagcagaaaaccaggaaaattttcttaaaatatccacaatattccttgagtgagtcagaatctatagccggttagtgatggtttcaggcagaatcgtgttcgtgtctgttttgctcgattcctttcctaagttaaataaatgcaagcctctgaacttctgtctataaaaaaaaaaaaaaaaa 1 51 1 01 1 51 2 01 2 51 3 01 3 51 4 01 4 51 5 01 5 51 6 01 16 51 11 7 01 287 51 458 01 61 8 51 789 01 959 51 111 10 01 128 10 51 145 11 01 1 61 115 1 17 8 12 01 195 12 51 211 13 01 13 51 14 01 14 51 15 01 15 51 16 01 16 51 17 01 17 51 18 01 18 51 50 10 0 15 0200250300350400450500550600650 10 7002775044800608507790094950 11 0 10 00 12 7 10 50 14 4 11 00 16 0 11 50 17 7 12 00 19 4 12 50 210 13 00226 13 50 14 00 14 50 15 00 15 50 16 00 16 50 17 00 17 50 18 00 18 50 18 71 PMP22 ... *Agtcgcccttctcagcgttccatcgatgcacacctgctatcgtggaacagcctagaaaccaagggactccaccaccaagtcacttcccctgctcgtgcagaggcacgggatgagtctgggtgacctctgcgccatgcgtgcgagacacgtgtgcgtttactgttatgtcggtcatatgtctgtacgtgtcgtgggccaacctcgttctgcctccagctttcctggttagcgcaacgcggctccacgaccacacgcacttcagggtggaagctggaagctgagacacaggttaggtggcgcgaggctgccctgcgctccgctttgctttgggattaatttattctgcatctgctgagaggggcaccccagccatatcttacactttggtaaagcagaaaaccaggaaaattttcttaaaatatccacaatattccttgagtgagtcagaatctatagccggttagtgatggtttcaggcagaatcgtgttcgtgtctgttttgctcgattcctttcctaagttaaataaatgcaagcctctgaacttctgtctataaaaaaaaaaaaaaaaa 1 51 1 01 1 51 2 01 2 51 3 01 3 51 4 01 4 51 5 01 5 51 6 01 16 51 11 7 01 287 51 458 01 61 8 51 789 01 959 51 111 10 01 128 10 51 145 11 01 1 61 115 1 17 8 12 01 195 12 51 211 13 01 13 51 14 01 14 51 15 01 15 51 16 01 16 51 17 01 17 51 18 01 18 51 50 10 0 15 0200250300350400450500550600650 10 7002775044800608507790094950 11 0 10 00 12 7 10 50 14 4 11 00 16 0 11 50 17 7 12 00 19 4 12 50 210 13 00226 13 50 14 00 14 50 15 00 15 50 16 00 16 50 17 00 17 50 18 00 18 50 18 71 PMP22 ... *Agtcgcccttctcagcgttccatcgatgcacacctgctatcgtggaacagcctagaaaccaagggactccaccaccaagtcacttcccctgctcgtgcagaggcacgggatgagtctgggtgacctctgcgccatgcgtgcgagacacgtgtgcgtttactgttatgtcggtcatatgtctgtacgtgtcgtgggccaacctcgttctgcctccagctttcctggttagcgcaacgcggctccacgaccacacgcacttcagggtggaagctggaagctgagacacaggttaggtggcgcgaggctgccctgcgctccgctttgctttgggattaatttattctgcatctgctgagaggggcaccccagccatatcttacactttggtaaagcagaaaaccaggaaaattttcttaaaatatccacaatattccttgagtgagtcagaatctatagccggttagtgatggtttcaggcagaatcgtgttcgtgtctgttttgctcgattcctttcctaagttaaataaatgcaagcctctgaacttctgtctataaaaaaaaaaaaaaaaa 1 51 1 01 1 51 2 01 2 51 3 01 3 51 4 01 4 51 5 01 5 51 6 01 16 51 11 7 01 287 51 458 01 61 8 51 789 01 959 51 111 10 01 128 10 51 145 11 01 1 61 115 1 17 8 12 01 195 12 51 211 13 01 13 51 14 01 14 51 15 01 15 51 16 01 16 51 17 01 17 51 18 01 18 51 50 10 0 15 0200250300350400450500550600650 10 7002775044800608507790094950 11 0 10 00 12 7 10 50 14 4 11 00 16 0 11 50 17 7 12 00 19 4 12 50 210 13 00226 13 50 14 00 14 50 15 00 15 50 16 00 16 50 17 00 17 50 18 00 18 50 18 71 PMP22...

... aggregation has been characterizedfor major nucleoproteins including histone H1 [14 ],topoisomerase II [15 ], lamin B1 [16 ] and SAF -A (hnRNP U) [17 ].It is known that the aggregation of DNA is ... DNA (0 .1 lg) (Fig. 1C, lanes 7 and 14 ). After a 2.7 kbp linearized-plasmid DNA was coaggregatedwith human nuclear fractions, an EJ reaction wasinitiated by the addition of ATP as a cofactor into ... wort-mannin-inactivated aggregates was alsotested (lanes 6–9). The aggregate and thesupernatant (sup.) were analyzed separately(lanes 10 and 11 ). The conditions in lanes 4,5 and 9 are parallel...

... 2 011 )doi :10 .11 11/ j .17 42-4658.2 011 .08240.xBovine glutamate dehydrogenase is potently inhibited by zinc and the majorimpact is on Vmaxsuggesting a V-type effect on catalysis or product release.Zinc ... compilation ª 2 011 FEBSthe glutamate binding domain. Both regions are part of the $ 18 ° movement of the NAD binding domainduring catalysis [30, 31] . Therefore it is possible that zinc, binding ... glutamate dehydrogenase. 314 0 FEBS Journal 278 (2 011 ) 314 0– 315 1 ª 2 011 The Authors Journal compilation ª 2 011 FEBSwith near equal affinity, although NAD(H) has anadditional binding site per subunit...

... 5A) . TheFdx ⁄ CYP17 5A1 ratio was saturated at 8 : 1, and theturnover rate at an Fdx ⁄ CYP17 5A1 ratio of 8 : 1 was4.9-fold greater than that at a ratio of 1 : 1 (Fig. 5B).The addition of appropriate ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 3 21 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... and a single bandwas observed (Fig. 1A) . These purification steps aresummarized in Table 1. The purified protein gave a UV–visible spectrum with a broad absorption peak at400 nm and a peak at...

... evolutionary aspects of invertebrate tachykinin and tachykinin-related peptideAtsuhiro Kanda, Kyoko Takuwa-Kuroda, Masato Aoyama and Honoo SatakeSuntory Institute for Bioorganic Research, Osaka, JapanTachykinins ... tachykinins: a review. Zool Sci 5,533–549.7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy-ama M, Minakata H, Chiba T, Metoki H, Satou Y &Satoh N (2004) Tachykinin and tachykinin receptor of an ... BioorganicResearch, 1- 1 -1 Wakayamadai, Shimamoto-cho, Mishima-gun, Osaka 618 -8503, JapanFax: + 81 75 962 211 5Tel: + 81 75 962 3743E-mail: kanda@sunbor.or.jpDatabaseNucleotide sequence data are...

... theconcentration of substrates gave a family of parallellines (Fig. 1) , indicating that the reaction mechanism is a ping-pong mechanism. This result demonstrated that the GPX mimic, 6-CySeCD, has the ... mito-chondrial swelling and a decrease in mitochondria integrity.TBARS content in ferrous sulfate ⁄ ascorbate-treatedmitochondria was analyzed by thiobarbituric acid assay[34]. In this assay, thiobarbituric ... Yasuhisa K & Tadashi M (19 86) Artificialreceptors for amino acids in water. Local environmentaleffect on polar recognition by 6A- amino-6B-carboxy- and 6B-amino- 6A- carboxy-beta-cyclodextrins. JAmChem...