0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Báo cáo khoa học: A novel pathway for sequential transformation of 7-dehydrocholesterol and expression of the P450scc system in mammalian skin pptx

Báo cáo khoa học: A novel pathway for sequential transformation of 7-dehydrocholesterol and expression of the P450scc system in mammalian skin pptx

Báo cáo khoa học: A novel pathway for sequential transformation of 7-dehydrocholesterol and expression of the P450scc system in mammalian skin pptx

... side-chain cleavage.4188 A. Slominski et al.(Eur. J. Biochem. 271) Ó FEBS 2004 A novel pathway for sequential transformation of 7-dehydrocholesterol and expression of the P450scc system in mammalian ... detected in controlplacenta, whole human skin, normal epidermal and immor-talized keratinocytes, dermal fibroblasts, squamous cellcarcinoma and five human melanomas. Thus, these dataclarify in detail ... from the plate w ithchloroform/methanol (1 : 1, v/v ), and the associatedradioactivity measured by scintillation counting.Side-chain cleavage of 7-DHC by placental and adrenalmitochondria. Incubations...
  • 11
  • 475
  • 0
Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "A HARDWARE ALGORITHM FOR HIGH SPEED MORPHEME EXTRACTION AND ITS IMPLEMENTATION" pptx

... necessary for these applications. The development of various kinds of accelera- tor hardware for the other processes in parsing is work for the future. The authors believe that the hardware approach ... are arranged in the incremental order of their key string in the dictionary, the pair for the top address and the number expresses the address range in the dictionary. Figure 3 shows the rela- ... Implementation Time Comparison for 5,000 Character Japanese Text toward achieving natural language parsing accel- erators, which is a new approach to speeding up the parsing. The implementation...
  • 8
  • 504
  • 0
Báo cáo khoa học: A natural osmolyte trimethylamine N-oxide promotes assembly and bundling of the bacterial cell division protein, FtsZ and counteracts the denaturing effects of urea docx

Báo cáo khoa học: A natural osmolyte trimethylamine N-oxide promotes assembly and bundling of the bacterial cell division protein, FtsZ and counteracts the denaturing effects of urea docx

... GTP and the intensity of light scattering wasmonitored for 15 min at 37 °C.Effect of TMAO on the GTPase activity of FtsZ A standard malachite green ammonium molybdate assaywas used to measure ... trimethylamine N-oxide promotesassembly and bundling of the bacterial cell divisionprotein, FtsZ and counteracts the denaturing effects of ureaArnab Mukherjee, Manas K. Santra, Tushar K. Beuria and ... pHdependence of the urea and guanidine hydrochloridedenaturation of ribonuclease A and ribonuclease T1.Biochemistry 29, 2564–2572.62 Pace CN (1986) Determination and analysis of urea and guanidine...
  • 13
  • 599
  • 0
Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

... [6,8,27] or toany other sequences available in FASTA and BLASTdatabase programs at the DNA Data Bank of Jap an.Recently, we reported the cloning and s equencing of the gene encoding 4-amino-3-hydroxybenzoate ... and 2-aminomuconic acid in the modified meta-cleavage path-way (Fig. 1B). The 2-aminomuconate deaminase from s trainAP-3 and that from strain JS45 have been purified and characterized in detail [5,6]. The nucleotide ... release of ammonia, are a key enzyme in the metabolic pathways of 2-amino phenol and its deriva-tives. However, little is known about the metabolic stepsthat lead to the release of ammonia and the...
  • 7
  • 613
  • 1
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... the synthesis of thermozeaxanthins and thermobiszeaxanthins, which are the main carotenoids of T. thermophilus [15]. The insertion of thermozeax-anthins and thermobiszeaxanthins into the cell ... electron acceptor, at 25 °C and atpH 7.4 in the presence of NADH as well as NADPH, the Kmvalue of the FNR for NADPH was about600-fold lower than that for NADH, and the Vmaxvalue of the FNR ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK...
  • 14
  • 617
  • 0
Báo cáo khoa học: A novel mechanism of V-type zinc inhibition of glutamate dehydrogenase results from disruption of subunit interactions necessary for efficient catalysis doc

Báo cáo khoa học: A novel mechanism of V-type zinc inhibition of glutamate dehydrogenase results from disruption of subunit interactions necessary for efficient catalysis doc

... within the hexamer. Specifically, these cru-cial ‘flex points’ appear to be at the back of the gluta-mate binding domain near residue 35 and within the GTP binding site. Again, the loop that contains ... demonstrate thatzinc does indeed cause changes in local flexibility, and it is interesting that all of the zinc-induced changes areregions located either at the base of the antennaeregion of the ... conformational states of GDH and how sub-strates (glutamate or norvaline) and zinc impact the overall stability and local flexibility of the enzyme. Asshown in Table 4, the addition of zinc...
  • 12
  • 544
  • 0
Báo cáo khoa học: A novel metallobridged bis(b-cyclodextrin)s fluorescent probe for the determination of glutathione doc

Báo cáo khoa học: A novel metallobridged bis(b-cyclodextrin)s fluorescent probe for the determination of glutathione doc

... devia-tion = 1.36), obtained from a series of 11 reagentblanks, and S is the slope of the standard curve. The relative standard deviation was 2.5%, obtained from a series of 11 standards each ... centrifugation. The final plasmasamples used in the determination of GSH wereobtained.Determination of GSH in plasma and accuracyassessment by recovery experiments In order to evaluate the applicability ... processes such as transport,protein synthesis, catabolism and metabolism [1]. Itcan also protect cells against reactive oxygen species and help them maintain an adequate intracellularredox status [2]....
  • 8
  • 429
  • 0
Báo cáo khoa học: A novel 2D-based approach to the discovery of candidate substrates for the metalloendopeptidase meprin pot

Báo cáo khoa học: A novel 2D-based approach to the discovery of candidate substrates for the metalloendopeptidase meprin pot

... protein database (release 48.8) with fixedcarbamidomethyl modification of cysteine residues, vari-able oxidation of methionine and variable deamidation of asparagine and glutamine. Parent and fragment ... [14–16] a variety of hitherto unkown substrates were found in conditioned media for the metzincin metalloendopep-tidases, a disintegrin and metalloprotease (ADAM)-17 and matrix metalloproteinase ... significanthits, the same spectra were interpreted with the web-based search engine mascot (version 2.1) against the same database and parameter settings (data notshown) [21]. The identification of...
  • 20
  • 506
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "A Novel Word Segmentation Approach for Written Languages with Word Boundary Markers" pptx

... stages. For written languages that have WBMs, such as for the Korean language, the majority of recentresearch has been based on a traditional WS ap-proach (Nakagawa, 2004). The first step of the traditional ... probabilities of all possible combinations of xt−2, xt−1, xt+1 and xt+2values. The model is trained by using the relative fre-quency information of the training data, and a smoothing technique is applied ... take place. For the Korean lan-guage, many researchers have adopted a traditional WS approach, which eliminatesall spaces in the user input and re-insertsproper word boundaries. Unfortunately,such...
  • 4
  • 268
  • 0
Báo cáo khoa học: A novel factor XI missense mutation (Val371Ile) in the activation loop is responsible for a case of mild type II factor XI deficiency doc

Báo cáo khoa học: A novel factor XI missense mutation (Val371Ile) in the activation loop is responsible for a case of mild type II factor XI deficiency doc

... 88,2611–2618.30 Solera J, Magallon M, Martin-Villar J & Coloma A (1991) Identification of a new haemophilia BM caseproduced by a mutation located at the carboxy terminalcleavage site of activation peptide. ... domain of hirudin and amidase activity in human alpha-throm-bin. Biochem J 289, 475–480.45 Baglia FA & Walsh PN (1996) A binding site for thrombin in the apple 1 domain of factor XI. J BiolChem ... activation and a slight delay in factor IX activation by thrombin-activated FXI.AbbreviationsFIX, coagulation factor IX; FIXa, activated factor IX; FXI, coagulation factor XI; FXIa, activated...
  • 11
  • 563
  • 0

Xem thêm

Từ khóa: báo cáo khoa học mẫubáo cáo khoa học y họcbáo cáo khoa học sinh họcbáo cáo khoa học nông nghiệpbáo cáo khoa học lâm nghiệpBáo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018Nghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitNGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDETrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Nghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chếChuong 2 nhận dạng rui roKiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namMÔN TRUYỀN THÔNG MARKETING TÍCH HỢPTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ