Báo cáo khoa học: Chaperone activity of recombinant maize chloroplast protein synthesis elongation factor, EF-Tu docx

... Chaperone activity of recombinant maize chloroplast protein synthesis elongation factor, EF-Tu Damodara Rao1, Ivana Momcilovic1, Satoru ... hypothesized that, in maize, this protein may show chaperone activity similar to prokaryotic EF-Tu [5,9–11].Fig. 6. Eﬀect of recombinant m aize pre -EF-Tu ( EF-Tu) on the activity of citra te synthase ... protecting chloroplast proteinsfrom thermal aggregation a nd inactiv ation.Keywords: chloroplast protein synthesis elongation factor (EF-Tu) ; chaperones ; heat stress; heat tolerance; Zea mays.Chloroplast...

Báo cáo khóa học: Chaperone activity of cytosolic small heat shock proteins from wheat pptx

... scattering can be used as a measure of effectiveness of the chaperone. Using this assay we tested therelative activity of the two wheat proteins in suppressingaggregation of MDH. As shown in Fig. 5, ... its chaperone activity, and likewise, data on activity of the class II pro-teins is very limited. We prepared puriﬁed, recombinant TaHsp16.9C-I and TaHsp17.8C-II and ﬁnd that the class II protein ... of its chaper-one activity has been performed. Wheat TaHsp17.8C-II is 33% identical overall to TaHsp16.9C-I. Only two previ-ous studies have examined the chaperone activity of thisclassofsHsp,andnoplantclassIIsHsphasbeentestedfor...

Tài liệu Báo cáo khoa học: Autolytic activity of human calpain 7 is enhanced by ESCRT-III-related protein IST1 through MIT–MIM interaction pptx

... Rockford, IL, USA). Bands of GST-fusion proteinswere detected by staining the PVDF membranes with CBB.In vitro binding assay using recombinant proteinsTen micrograms of GST (negative control) ... epidermal growth factor, suggesting involvement of calpain 7 in the ESCRT system [28].On the basis of the resolved 3D structure, the MITdomain of VPS4 forms three-helix bundles. ESCRT-IIIproteins ... bindingexperiments, using puriﬁed recombinant proteins andcultured mammalian cells expressing epitope-taggedproteins. We also investigated the effect of this interac-tion on the autolysis of calpain 7.ResultsGlutathione-S-transferase...

Tài liệu Báo cáo khoa học: Unique features of recombinant heme oxygenase of Drosophila melanogaster compared with those of other heme oxygenases studied docx

... theexistence of several types of hemin conformation in the protein pocket is consistent with this non a-speciﬁcproduction of biliverdin. We expected that DmDHOwould produce the c-isomer of biliverdin ... spectrum of hexa-coordinated heme protein. The absorption spectrum of theferric complex was not inﬂuenced by changing the pH of thesolution. Interestingly, an EPR study revealed that the iron of ... Aspectrum of the ferrous–CO form of verdoheme was notdetected during the reaction from hemin under oxygen andCO. Degradation of hemin catalyzed by DmDHO yieldedthree isomers of biliverdin, of which...

Tài liệu Báo cáo khoa học: ATPase activity of magnesium chelatase subunit I is required to maintain subunit D in vivo ppt

... for thefunction of BchI among the various functions of AAA+proteins. The AAA+proteins represent one type of molecular chaperones and their function is to control thefate of proteins or DNA. ... This is done by facilitating protein folding and unfolding, assembly and disassembly of protein complexes, degradation of protein, replication and tran-scription of DNA, etc. [11–13]. Here we ... the absence of XAN-H protein. In the Xantha-hclo 125, -hclo 157and -hclo 161mutants,however, the lack of XAN-G has to be explained by aninhibited activity of the deﬁcient XAN-H proteins....

Tài liệu Báo cáo khoa học: High activity of human butyrylcholinesterase at low pH in the presence of excess butyrylthiocholine pptx

... themechanism of action of chymotrypsin: the role of the low barrierhydrogen bond. Biochemistry 36, 4576–4584.46. Warshel, A. (1998) Electrostatic origin of the catalytic power of enzymes and the role of ... general features of therecently determined X-ray structure of human BuChE [7,8].In particular, most of the essential features of the catalyticsite (i.e. a catalytic triad of Ser-His-Glu, an ... kcatand bkcatare consistent with titration of thecatalytic histidine, H438(440). The persistence of activity inthe presence of the protonated form of the catalytic histidineis inconsistent...

Báo cáo khoa học: Biochemical characterization of recombinant dihydroorotate dehydrogenase from the opportunistic pathogenic yeast Candida albicans pot

... refer to amino-acid residues of the C. albicans protein. (B) Alignment of the catalytic centre of the recombinantly expressed C. albicans DHODH and amino-acid sequences of different DHODH family ... of recombinant DHODH should expedite discov-ery of more potent agents for growth controlstrategies in C. albicans, and permit the screening of a large number of compounds, the examination of structure activity ... estimatedfrom ﬂuorimetric cofactor analyses of the two recom-binant enzymes was in the range 0.2–0.3 mol ﬂavin permol protein. Kinetic characterization Activity measurements of CaDHODH and DNCaD-HODH...

Báo cáo khoa học: Antimicrobial activity of histones from hemocytes of the Paciﬁc white shrimp ppt

... Devices).ResultsIdentification of histone proteins in the hemocytesIn the course of an initial proteomic inve stigation of shrimpimmune function, simple one-dimensional SDS/PAGEanalysis of the hemocytes soluble proteins ... the results of a proteomic investigation of hemocyte antimicrobial peptides of the P acific whiteshrimp, L. vannamei, and the r ole of histones as potentiallyimportant components of their immune ... sequence(SGRGKGGKVKGKSKSRSSRAGLQFPVGRIHRLLRKGNY). After synthesis, the peptide, named H2A 2–39,was purifiedby HPLC.Approximately 0 .2 mg ofpeptide wasÓ FEBS 2004 Antimicrobial activity of shrimp histone proteins (Eur. J. Biochem....

Báo cáo khoa học: Cytotoxic activity of nucleoside diphosphate kinase secreted from Mycobacterium tuberculosis pptx

... supernatant.Fig. 6. Autophosphorylation of recombinant Ndk and mutant proteins.(A) Ndk and mutant proteins (1 lg) were incubated in the presence of 10 lCi of [c-32P]ATP in 20 lL of reaction volume. The reaction ... of 2 lL of 10% SDS. The samples were boiledfor 10 min and separated by 15% SDS/PAGE. Analysiswas by autoradiography.Enzymatic activity of NdkEnzymatic activity of purified Ndk or its activity ... of M. tuberculosis was assayed as describedpreviously [14]. In brief, 1 lg of purified protein wasincubated with 1 mM(final concentration) of each of NDP(where N is G, C or U) and 10 lCi of...

Báo cáo khoa học: Molecular cloning of the Matrix Gla Protein gene from Xenopus laevis Functional analysis of the promoter identiﬁes a calcium sensitive region required for basal activity doc

... region, one copy of adouble stranded oligonucleotide spanning the region from)70 to )36 was fused upstream of pTATALUC. Evaluation of reporter activity following transfection of A6 cellsrevealed ... detected in bone, cartilage and in soft tissues suchas he art, kidney, and lung in a variety of species [4,6,7].MGP is also secreted in vitro by a number of cell lines of different origins including ... members of this vitamin K-dependent protein family can bind to mineral and, in particular, calcium-containing-mineral such as hydroxyapatite [2].Although the exact m ode of action of MGP at...

Xem thêm