Báo cáo khoa học: C-terminal truncated cannabinoid receptor 1 coexpressed with G protein trimer in Sf9 cells exists in a precoupled state and shows constitutive activity ppt

Báo cáo khoa học: C-terminal truncated cannabinoid receptor 1 coexpressed with G protein trimer in Sf9 cells exists in a precoupled state and shows constitutive activity ppt

Báo cáo khoa học: C-terminal truncated cannabinoid receptor 1 coexpressed with G protein trimer in Sf9 cells exists in a precoupled state and shows constitutive activity ppt

... was 5¢-GC G GAT CC G ACC ATG GCG AAG TCG ATC CTA GAT GGC-3¢. The reverse primer for the full-length CB1 gene, with EcoRI and NotI restriction sites, was 5¢-GAA T GC GGC CGC TCA CTT TTC GAA TTG ... oligomer. Our results show that at least the distal C-terminal tail ( 418 –472) is not involved in CB1( 417 ) G +G Anti-Flag M2 IgG Anti-His tag IgG Anti-His tag IgG Anti -G i1 /G...
Ngày tải lên : 23/03/2014, 07:20
  • 10
  • 313
  • 0
Báo cáo khoa học: Identification of sites of phosphorylation by G-protein-coupled receptor kinase 2 in b-tubulin ppt

Báo cáo khoa học: Identification of sites of phosphorylation by G-protein-coupled receptor kinase 2 in b-tubulin ppt

... + 81 35992 10 33, E-mail: tatsuya.haga@gakushuin.ac.jp Abbreviations: GPCR, G- protein- coupled receptor; GRK, G- protein- coupled receptor kinase; PP 2A, phosphatase 2A; MAP, microtubule-associated ... sites in M 2 receptors [14 ]. These regions are assumed to undergo a conformational change on agonist binding and to be involved in the interaction with G- proteins [16 ,1...
Ngày tải lên : 17/03/2014, 09:20
  • 10
  • 267
  • 0
Tài liệu Báo cáo khoa học: Differentiation stage-dependent preferred uptake of basolateral (systemic) glutamine into Caco-2 cells results in its accumulation in proteins with a role in cell–cell interaction pptx

Tài liệu Báo cáo khoa học: Differentiation stage-dependent preferred uptake of basolateral (systemic) glutamine into Caco-2 cells results in its accumulation in proteins with a role in cell–cell interaction pptx

... SYELPDGQVITIGNER FRCPEALFQPSFLGME SCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQK EITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK Q EYDESGPSIVHR KCF ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYP GQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPS SGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPR ... KCF ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYP GQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPS SGQPSAPGAYPATGPYGAPA...
Ngày tải lên : 20/02/2014, 01:20
  • 15
  • 506
  • 0
Báo cáo khoa học: Methods to monitor the quaternary structure of G protein-coupled receptors doc

Báo cáo khoa học: Methods to monitor the quaternary structure of G protein-coupled receptors doc

... well validated GPCR radioligands are available, attempts have been made to generate stand- ard curves of GPCR ligand-binding site number against fluorescence or luminescence signals to allow absolute ... Using the histamine H1 receptor as a model, Bakker et al. [ 41] showed that although single point mutations in both transmembrane region III and transmembrane region VI prevented bindi...
Ngày tải lên : 16/03/2014, 22:20
  • 12
  • 337
  • 0
Báo cáo khoa học: Poly(ADP-ribose) polymerase-1 protects excessive DNA strand breaks from deterioration during repair in human cell extracts pot

Báo cáo khoa học: Poly(ADP-ribose) polymerase-1 protects excessive DNA strand breaks from deterioration during repair in human cell extracts pot

... cross-linking assay, we reveal that PARP -1 is always involved in repair of a uracil-containing oligonucleotide and that it binds to the damaged DNA during the early stages of repair. Inhibition ... of PARP -1 in cellular BER. Numerous studies have indi- cated that PARP -1 may play an important role in living cells, as PARP -1- deficient cells are genetically unstable and sen...
Ngày tải lên : 23/03/2014, 13:20
  • 10
  • 187
  • 0
Tài liệu Báo cáo khoa học: Epidermal growth factor receptor in relation to tumor development: EGFR gene and cancer ppt

Tài liệu Báo cáo khoa học: Epidermal growth factor receptor in relation to tumor development: EGFR gene and cancer ppt

... an extracellular ligand-binding domain; a transmembrane domain; an intracellular tyrosine kinase domain; and a C-terminal regulatory domain [2]. The extracellular domain is subdivided further into ... three groups (a) ligands that specifically bind to EGFR (including EGF, transforming growth factor -a, amphi- regulin and epigen); (b) those that bind to EGFR and ERBB4 (including bet...
Ngày tải lên : 16/02/2014, 09:20
  • 8
  • 684
  • 0
Tài liệu Báo cáo khoa học: Epidermal growth factor receptor in relation to tumor development: EGFR-targeted anticancer therapy doc

Tài liệu Báo cáo khoa học: Epidermal growth factor receptor in relation to tumor development: EGFR-targeted anticancer therapy doc

... epidermal growth factor receptor mutations. Br J Cancer 95, 998 10 04. 16 Sutani A, Nagai Y, Udagawa K, Uchida Y, Koyama N, Murayama Y, Tanaka T, Miyazawa H, Nagata M, Kanazawa M et al. (2006) Gefitinib ... 78 Yoshida et al. [17 ] Gefitinib 21 91 Sunaga et al. [18 ] Gefitinib 19 76 Tamura et al. [19 ] Gefitinib 28 75 Sequest et al. [20] Gefitinib 34 55 Sugio et al. [ 21] Gefitinib 19 63 I....
Ngày tải lên : 16/02/2014, 09:20
  • 7
  • 511
  • 0
Báo cáo khoa học: Epidermal growth factor receptor-regulated miR-125a-5p – a metastatic inhibitor of lung cancer potx

Báo cáo khoa học: Epidermal growth factor receptor-regulated miR-125a-5p – a metastatic inhibitor of lung cancer potx

... Collection (Manassas, VA, USA) and maintained in Ham’s F12K medium (Invitrogen, Carlsbad, CA,USA) supplemented with 10 % fetal bovine serum (Shanghai Sangon Biological Engineering Techno- logy and Services ... to regulating migration and invasion, EGFR signaling also in uences proliferation, angiogen- esis, apoptosis, and cell cycle progression [15 ]. After finding that miR -12 5...
Ngày tải lên : 07/03/2014, 00:20
  • 8
  • 536
  • 0
Báo cáo khoa học: Modulation of glucocorticoid receptor-interacting protein 1 (GRIP1) transactivation and co-activation activities through its C-terminal repression and self-association domains pptx

Báo cáo khoa học: Modulation of glucocorticoid receptor-interacting protein 1 (GRIP1) transactivation and co-activation activities through its C-terminal repression and self-association domains pptx

... sequence-dependent 11 22 11 22 14 62 14 62 5 14 62 14 62 11 21 112 1 563 563 5 765 In p u t 10 % I np u t 1 0 % G ST GST G ST -G R IP1 13 05 -13 98 GST-GRIP1 13 05 -13 98 GRIP1 GRIP1 1 2 3 4 5 9 6 10 10 11 11 7 12 12 8 HA.GRIP1 563 -14 62 HA.GRIP1 563 -14 62 HA.GRIP1 5-765 HA.GRIP1 5-765 HA.GRIP1 5 -11 21 HA.GRIP1 5 -11 21 HA.GRIP1 563 -1 1 21 HA.GRIP1 563 -...
Ngày tải lên : 07/03/2014, 12:20
  • 12
  • 424
  • 0
Báo cáo khoa học: Pleiotropy of leptin receptor signalling is defined by distinct roles of the intracellular tyrosines docx

Báo cáo khoa học: Pleiotropy of leptin receptor signalling is defined by distinct roles of the intracellular tyrosines docx

... cells [6–9]. As a class I cytokine receptor, LEPRb activates the janus kinase ⁄ signal transducer and activator of tran- scription (JAK ⁄ STAT) signalling pathway [10 ,11 ]. Lig- and binding to LEPRb ... residues and appears to be signalling-inactive [14 ]. Murine LEPRb contains three intracellular tyrosine residues that are conserved in mammals and birds [15 ,16 ]. Tyr 113 8 i...
Ngày tải lên : 07/03/2014, 16:20
  • 11
  • 420
  • 0

Xem thêm

Từ khóa: