Báo cáo khoa học: Sequences and structural organization of phospholipase A2 genes from Vipera aspis aspis, V aspis zinnikeri and Vipera berus berus venom Identification of the origin of a new viper population based on ammodytin I1 heterogeneity docx
Báo cáo khoa học: Sequences and structural organization of phospholipase A2 genes from Vipera aspis aspis, V. aspis zinnikeri and Vipera berus berus venom Identification of the origin of a new viper population based on ammodytin I1 heterogeneity docx
... et al.(Eur. J. Biochem. 270) Ó FEBS 2003 Sequences and structural organization of phospholipase A 2 genes from Vipera aspis aspis, V. aspis zinnikeri and Vipera berus berus venom Identification ... of acquiring new functions [9,11].In this paper, we extend the study of PLA2 genes to the French vipers Vipera aspis aspis (V. a. aspis) , Vipera aspis zinnikeri (V. a. zinnikeri) , and Vipera berus ... that of the V. am. ammodytes ammodytin I1 gene.All PLA2 genes contained a TAA stop codon, anAATAAA polyadenylation site 80 bp downstream from the stop codon, and a TATA-like box (CATAAAA) 270...
- 10
- 451
- 0
Báo cáo khoa học: Photosynthetic acclimation: Structural reorganisation of light harvesting antenna – role of redox-dependent phosphorylation of major and minor chlorophyll a/b binding proteins pot
... plants,depending on the light conditions and the species anal-ysed [12].Environmental conditions can fluctuate on a time-scale of seconds, days and months. Photosyntheticorganisms have evolved a number of ... differbetween the aquatic unicellular green alga Chlamydo-monas reinhardtii and land plants. In particular, the greater extent of state transitions in Chlamydomonascompared with higher plants, such as Arabidopsis, ... beenunsuccessful to date. Nevertheless, by adopting analternative approach, a small family of three thyla-koid-associated kinases (TAKs) have been identifiedin A. thaliana as candidates for LHCII kinasesthrough...
- 13
- 343
- 0
Báo cáo khoa học: PRDM1/Blimp1 downregulates expression of germinal center genes LMO2 and HGAL pot
... 5¢-TGGATCAATCTCAAATGCATTACACTACGAGCACGCGACCAGACTTAAAGCCTACCTTCTGTG-3¢ and for HGAL-mutant#2: 5¢-TATAAAAATTTGTACACACAGTCTTAGAGGACATACGTGTGTCGTGGCTAAATGCCTAGGAGTGAAATTGC-3¢ and 5¢-GCAATTTCACTCCTA ... (Stratagene, La Jolla, CA, USA).Primers used for mutagenesis with mutations in lower caseare HGAL-mutant#1: 5¢-CACAGAAGGTAGGCTTTAAGTCTGGTCGCGTGCT CGTAG TG TAATG CATTTG AGATTGATCCA-3¢ and ... GGCATTTAGC CAC GACACACGTATGTCCTCTAAGACTGTGT GTACAAATTTTTATA-3¢.Transfections and luciferase assaysNon-Hogdkin’s lymphoma cell lines were transfected byelectroporation using either a BioRad...
- 11
- 343
- 0
Báo cáo khoa học: Distinguishing between different pathways of bilayer disruption by the related antimicrobial peptides cecropin B, B1 and B3 pptx
... 35-amino-acid peptide amidesCB (H)KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL)CONH2), CB1 (H)KWKVFKKIEKMGRNIRNGIVKAGPKWKVFKKIEK)CONH2)andCB3(H)AIAVLGEAKALMGRNIRNGIVKAGPAIAVLGEAKAL)CONH2)used ... bacteria, the production of cationicantimicrobial peptides is probably a survival strategy toobtain an ecological advantage over competitors [8–10]. Ininvertebrates and plants, which lack the ... in their lipid-bound state by analysis of the thermaltransitions that these peptide–lipid interactions generate and has been shown to provide valuable information for the analysis of materials...
- 10
- 443
- 0
Báo cáo khoa học: The noncatalytic C-terminus of AtPOLK Y-family DNA polymerase affects synthesis fidelity, mismatch extension and translesion replication ppt
... AtPOLK Y-family DNApolymerase affects synthesis fidelity, mismatch extension and translesion replicationMarı´ a Victoria Garcı´ a- Ortiz, Teresa Rolda´n-Arjona and Rafael R. ArizaDepartamento ... a function of the dNTP concentration and the data werefitted to the Michaelis–Menten equation. The apparentKm and V maxsteady state kinetic parameters for the incorporation of both correct and incorrect ... localization signal, and a candidate PCNA-interaction domain.To better understand the role of the C-terminaldomain of this Y-family DNA polymerase during DNAsynthesis, we compared the catalytic...
- 11
- 270
- 0
Báo cáo khoa học: Cytokinin-induced structural adaptability of a Lupinus luteus PR-10 protein potx
... differencewas assumed to be a manifestation of the adaptability of the PR-10 fold to the presence of the hormoneligands [25]. As a consequence of the straightening of the a3 -helix, the cavity of LlPR-10.2B ... model of the LlPR-10.2B protein has good overall geometry and Ramachandran statistics (Table 1). The quality of the electron density maps is high and there are only a few less clear areas in the ... and dissociation constants (Kd). The heats of mixing were subtracted. The concentrations of the protein and ligands were estimated spectrophotometrically.Antifungal assays The antifungal activity...
- 14
- 410
- 0
Báo cáo khoa học: Solubility-dependent structural formation of a 25-residue, natively unfolded protein, induced by addition of a seven-residue peptide fragment pot
... the valuesmeasured by Wolfenden et al. [16]. Those of Pro and Arg sidechains and the backbone are taken from the values measured byPrivalov et al. [17]. pK values of the amino acid side chains, a- COOH ... calculated using the hydration poten-tials of the amino acid side chains and the backbone[16,17]. In addition, because the individual hydrationpotential for ionizable side chains, a- COOH and a- NH3+termini ... solutionat a standard concentration of p, R is gas constant, T isabsolute temperature, cpis the activity coefficient of p and Spis the concentration of p. As a first approximation, if pis...
- 12
- 338
- 0
Báo cáo khoa học: Stage-specific expression of Caenorhabditis elegans ribonuclease H1 enzymes with different substrate specificities and bivalent cation requirements ppt
... 10111213141516 A 5'-GCGAAUUUAGGGCGAgagcaaacttctcta-3'5'-GCGAAUUUAGGGCGAgagcaaacttctcta-3'5'-GCGAAUUUAGGGCGAgagcaaacttctcta-3'5'-GCGAAUUUAGGGCGAgagcaaacttctcta-3'Ce-RNH1α, ... gene.rnh-1.0αrnh-1.0βαβ A UGAAAAUUUAGGAGUCAAACGUUGUUUUAGAUUCAAGAAAαβBFig. 3. Alternative splicing of rnh-1. 0a and rnh-1.0b. (A) Schematicpresentation of alternative splicing. Exons are represented asboxes, and the characters a and b above the ... beendiscussed. The dsRNA binding and RNase H activity of Saccharomyces cerevisiae RNase H1 depends on the concentration of Mg2+ions and the existence of dsRNA, and the activity of mutant enzymes lackingdsRHbd...
- 10
- 385
- 0
Báo cáo khoa học: In vivo cross-linking of nucleosomal histones catalyzed by nuclear transglutaminase in starfish sperm and its induction by egg jelly triggering the acrosome reaction pdf
... (A 260)]. The reaction was stoppedby the addition of EDTA to a final concentration of 5 mM and then cooled on ice. The S1 fraction was obtained as the supernatant by centrifugation of the reaction ... the charge and conformation of the molecules [1]. The majority of thesemodifications occur at the N-terminal region of the corehistones and possibly these reactions modulate the affinity of the ... activates Ca2+influx toinduce the acrosome reaction, resulted in a significantelevation of the p28 content in the nucleus. This is the firstdemonstration of an in vivo activation of transglutaminaseleading...
- 10
- 503
- 0
Báo cáo khoa học: Genome-wide identification of glucosinolate synthesis genes in Brassica rapa potx
... will allow for the easy identification of relevant genes in Brassicas. The identification and characteriza-tion of glucosinolate synthesis genes in Chinese cab-bage would pave the way for further ... proceduresConstruction of the cDNA and BAC librariesB. rapa cultivar ‘Chiifu’ was used for library construction based on the agreement of the Multinational BrassicaGenome Project Consortium. Total RNA ... both Arabidopsis and B. rapa (Fig. 5A) . The AOP2structure of B. rapa was compared with that of B. oler-acea and Arabidopsis. All three species contained fourexons and three introns, along with...
- 16
- 367
- 1
Từ khóa: báo cáo khoa học mẫubáo cáo khoa học y họcbáo cáo khoa học sinh họcbáo cáo khoa học nông nghiệpbáo cáo khoa học lâm nghiệpbáo cáo khoa học thủy sảnNghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhTrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Nghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Định tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinThơ nôm tứ tuyệt trào phúng hồ xuân hươngQuản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)QUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ