Báo cáo khoa học: Cloning and expression of a tomato cDNA encoding a methyl jasmonate cleaving esterase pdf

Báo cáo khoa học: Cloning and expression of the ﬁrst nonmammalian interleukin-11 gene in rainbow trout Oncorhynchus mykiss pdf

... the 5¢- and 3¢-UTR are underlined and the 13 repeats with a consensus of CCAATGATGATCCAAGAAATCCACACTACAG (31 bp) in the 3¢-UTR are numbered and distinguished from each other by alternate highlightingin ... insertion of 12 repeats with a consensus of CCAATGATGATCCAAGAAATCCACACTACAG(31 bp) in the 3¢-UTR of the cDNA sequence (Fig. 1). A TATA box was identiﬁed 28 bp upstream from the cDNA sequence.The ... same intron phase, as mammalianIL-11 genes. The 204 amino acid trout IL-11 translation has a predictedsignal peptide of 26 amino acids and mature peptide of 178 amino acids,with a calculated...

Báo cáo khoa học: Cloning and expression of a tomato cDNA encoding a methyl jasmonate cleaving esterase pdf

... Cloning and expression of a tomato cDNA encoding a methyl jasmonate cleaving esterase Christiane Stuhlfelder, Martin J. Mueller and Heribert WarzechaLehrstuhl fu¨r Pharmazeutische ... Intra-cellular s eparation of MeJA synthesis and hydrolysis wouldbe one way to avoid a treadmill situation, yet analysis of tomato MJE and Arabidopsis JMT reveals no evidence forsubcellular targeting ... application of JA. These experiments demonstrate that individual mem-bers of the jasmonate family are involved – at least inArabidopsis – in different signalling pathways.An Arabidopsis(jar1)mutantwithadefectinthejasmonate...

Báo cáo khóa học: Cloning and expression of murine enzymes involved in the salvage pathway of GDP-L-fucose ppt

... bpR5¢-GGCTTTGGCCATACGCATAC-3¢ 3081P a 5¢-ACGGCCAGCGGCTCGCA-3¢ 3037FK long F 5¢-GCAGGACGTGCTGAGGAACT-3¢ 2865 64 bpR5¢-CAGTCTGCGGGCATTCTGT-3¢ 2911P a 5¢-CCACAACGGGCAACCGAGCG-3¢ 2889PP F 5¢-AGCTGGGCTTACAATCCATAGCT-3¢ ... needed.AcknowledgementsWe thank Tuula Kallioinen and Sirkka-Liisa Kauranen for skilledtechnical assistance in molecular biology, and Kati Vena¨la¨inen and Leena Penttila¨for assistance ... 5¢-AGCTGGGCTTACAATCCATAGCT-3¢ 1118 79 bpR5¢-TGAATGACACAGGCTGTTCCA-3¢ 1176P5¢-AGTGTCTCTCCAAGTGTTCCTGAGCGCT-3¢ 1144 a Probe is antisense strand.Table 2. Ratio of long splice variant to short splice variant of L-fucokinase.Tissue...

Tài liệu Báo cáo khoa học: Cloning and characterization of CBL-CIPK signalling components from a legume (Pisum sativum) ppt

... C)AATTTC-3¢ PsCBL (degenerate forward)45¢-GTATCAGCTTC(C ⁄ T)TCAAATGTC-3¢ PsCBL (degenerate reverse)55¢-CCATCACAAGAAACTAGAGAAAC-3 PsCIPK (5¢UTR forward)65¢-TTAAGTACTATAAAT-ACACAGCCTA-3¢ PsCIPK (3¢UTR ... T)GC(C ⁄ G ⁄ T)AAGGT-3¢ PsCIPK (degenerate forward)25¢-ACAAA (A ⁄ C )A( A ⁄ G) (A ⁄ G ⁄ T )A( C ⁄ T) (A ⁄ C ⁄ G)ACACCACAAGACC)3¢ PsCIPK (degenerate reverse)35¢-CTTAT(C ⁄ G)AACAAGGAA (A ⁄ C)AATTTC-3¢ PsCBL ... nucleolus and sti-mulated by phosphorylation with CK2 and cdc2 proteinkinases. Plant J 25, 9–17.32 Yadav N, Chandok MR, Prasad J, Bhattacharya S,Sopory SK & Bhattacharya A (1997) CharacterizationStress-induced...

Tài liệu Báo cáo khóa học: Cloning and characterization of two distinct isoforms of rainbow trout heat shock factor 1 ppt

... Japan) and reared on a commercialdiet at 15 °C. Cloning of HSF cDNA A random primed kZAPII cDNA library was constructedby using a kZapII predigested EcoRI/calf intestinal alkalinephosphatase-treated ... PCR was performed with the M13forward primer (5¢-CCCAGTCACGACGTTGTAAAACG-3¢)asasenseprimerandHSF1-speciﬁc primers (forHSF 1a, 5¢-GAAGCAGCTTGTCCAGTACACTAA-3¢;forHSF1b,5¢-GAAGCAGCTGGTCCAGTACACCTC-3¢)asantisense ... 5¢-GAAGCAGCTGGTCCAGTACACCTC-3¢; HSF1b reverse, 5¢-GGCTGAATAAACCATGCCAGTAGC-3¢; HSC70 forward, 5¢-ACATCAGCGACAACAAGAGG-3¢; HSC70 reverse, 5¢-AGCAGGTCCTGGACATTCTC-3¢. The ampliﬁed products were visualizedby...

Báo cáo khoa học: Cloning and characterization of the genes encoding toxic lectins in mistletoe (Viscum album L) pot

... and XhoIML3p A- chain5¢-GATATACATATGTACCGTCGTATTAGCCTTCGTGTCACGGAT-3¢5¢-CACACGAATTCTTATTAAGAAGAAGAAGAACGGTCCCTGCATAC-3¢NdeI and EcoRIML3.1p A- chain5¢-GATATACATATGTACGAGCGTCTTCGTCTTCGTGTTACGCATC-3¢5¢-CACACGAATTCTTATTAAGAAGAAGAAGAACGGTCCCTGCATAC-3¢NdeI ... and XhoIML2p A- chain5¢-GATATACATATGTACGAGCGTCTTCGTCTTCGTGTTACGCATC-3¢5¢-CACACCTCGAGTTATTAAGAAGAAGACGGACGGTCCCGGCATAC-3¢NdeI and XhoIML3p A- chain5¢-GATATACATATGTACCGTCGTATTAGCCTTCGTGTCACGGAT-3¢5¢-CACACGAATTCTTATTAAGAAGAAGAAGAACGGTCCCTGCATAC-3¢NdeI ... for cloning, 5¢-AAAAATGCATGAAGTTGATTGCTTGCATTAACTCAT-3¢ (3¢UTR), 5¢-AAAAATGCATAGGGATGAAGTTGATTGCTTGCC-3¢ (3¢UTR) containing the NsiIrecognition site for cloning, and 5¢-CACAAGGTGGCTAAGGCTTCTTCCG-3¢...

Báo cáo Y học: Cloning and expression of sterol D14-reductase from bovine liver potx

... vector, and sequenced on both strands. The cloned cDNA was 1370 bp long and contained an ORF of 1257 bp, encoding a protein of 418 amino a cids with a calculated molecular mass of 46 751 Da.The ... Beccari4, Maria Agnese Della Fazia4 and Giuseppe Servillo41Department of Internal Medicine, University of Perugia, Italy;2Department of Pharmacological Sciences, University of Milan,Italy;3Department ... Cloning and expression of sterol D14-reductase from bovine liverRita Roberti1, Anna Maria Bennati1, Giovanni Galli2, Donatella Caruso2, Bruno Maras3, Cristina Aisa4,Tommaso...

Báo cáo Y học: Cloning and expression of two novel aldo-keto reductases from Digitalis purpurea leaves potx

... EMBL database and are available underaccession numbers AJ309822 and AJ309823, respectively.DpAR1 and DpAR2 contain 948 bp long ORFs encoding 315 amino acids of a calculated molecular mass 34 ... (P23901); Avena, Avena fatua (S61421); Sesbania, Sesbaniarostrata (CAA11226); Oryza, Oryza sativa (AAK52545); Medicago,M. sativa (X97606). AR proteins from mammals were used as theoutgroup: human ... purpurea (this study); AAC23647,AAD32792, CAB88350 and AAC2346,Arabidopsis thaliana;Medicago,M. sativa[16]. The amino-acid residues identical to theDpAR1 sequence are indicated by dots. Gapsare...

Báo cáo khoa học: Cloning, over-expression, puriﬁcation and characterization of Plasmodium falciparum enolase doc

... 2004 Cloning, over -expression, purification and characterization of Plasmodium falciparumenolaseIpsita Pal-Bhowmick, K. Sadagopan, Hardeep K. Vora, Alfica Sehgal*, Shobhona Sharma and Gotam K. JaroriDepartment ... falciparum NF54 LGANAILAISMAVCRAGAAANKVSLYKYLAQLAGKKSDQMVLPVPCLNVINGGSHAGNKL 171 P. falciparum K1 LGANAILAISMAVCRAGAAPNKVSLYKYLAQLAGKKSDQMVLPVPCLNVINGGSHAGNKL 171 P. yoelii LGANAILAISMAICRAGAAANKTSLYKYVAQLAGKNTEKMILPVPCLNVINGGSHAGNKL ... 5¢-CCGGAATTCGGTACCATGGCTCATGTAATAAC-3¢ and PfenoPstIXhoI (30-mer) 5¢-CATTCTCGAGCTGCAGATTTAATTGTAATC-3¢. A gametocytic cDNA library constructed from theNF54 strain was u sed for the amplification of the enolasegene...

Báo cáo khoa học: Silencing the expression of mitochondrial acyl-CoA thioesterase I and acyl-CoA synthetase 4 inhibits hormone-induced steroidogenesis potx

... forACS4 and MTE-I in the hormonal regulation of steroidogenesis as a newpathway of arachidonic acid release different from the classical phospho-lipase A 2cascade.AbbreviationsAA, arachidonic ... thioesterasesare a group of enzymes that catalyze the hydrolysis of acyl-CoA to the nonesteriﬁed fatty acid and CoA [19] and that they can release AA from the arachidonoyl-CoA, so far, the phospholipase A 2pathway ... the adrenal gland, ovary, testis, placenta and brain and are essential for maintaining normalbody homeostasis and reproductive capacity. The bio-synthesis of all steroid hormones begins at the...

Xem thêm