Báo cáo khoa học: Three-step hydroxylation of vitamin D3 by a genetically engineered CYP105A1 doc

... 43–66.8 Sasaki J, Miyazaki A, Saito M, Adachi T, Mizoue K,Hanada K & Omura S (1992) Transformation of vita-min D3 to 1 alpha,25-dihydroxyvitamin D3 via25-hydroxyvitamin D3 using Amycolata sp. ... 7500E-mail: tsakaki@pu-toyama.ac.jpDatabaseStructural data are available in the ProteinData Bank database under the accessionnumbers 3CV8 and 3CV9(Received 14 May 2010, revised 1 July2010, accepted ... 2010 The Authors Journal compilation ª 2010 FEBS 4009 Three-step hydroxylation of vitamin D3 by a genetically engineered CYP10 5A1 Enzymes and catalysisKeiko Hayashi1, Kaori Yasuda1, Hiroshi...

Tài liệu Báo cáo khóa học: The lysozyme of the starfishAsterias rubens A paradigmatic typei lysozyme docx

... 12 0A PTHanalyser.Synthesis of cDNATotal RNA was extracted using the RNeasy Mini Kit(Qiagen) according to the manufacturer’s instructions. Itwas treated with RNAase-free DNAase I (Pharmacia) ... have approximately the sameTable 1. Primer sequences.Primer (5¢ﬁ3¢)CorrespondingpeptideAS1 GGTTGCCTGAGRTGYATHTG a GCLRCICAS3 GGGCTATTGGTCAGACGCTACACTC GYWSDATLAS3R GAGTGTAGCGTCTGACCAATAGCC ... lysozyme of the bivalve Tapes japonica [3], with the so-called chlamysin of Chlamys islandica [4,5], and also with a hypotheticalsecreted protein of the nematode Caenorhabditis elegans andwith putative...

Tài liệu Báo cáo khoa học: Molecular basis of glyphosate resistance – different approaches through protein engineering doc

... substrate binding and as a catalytic base.To complete the reaction, attack by the lone pair of the glyphosate nitrogen on the carbonyl carbon of CoA-SAc results in a tetrahedral inter-mediate. ... The shikimate pathway that leads tothe biosynthesis of aromatic amino acids,and the mode of action of glyphosate onthe reaction catalyzed by EPSPS.Mechanisms of glyphosate resistance L. Pollegioni ... theshikimate pathway leading to the synthesis of aromaticamino acids and other aromatic compounds in plants,fungi, bacteria [9], and apicomplexan parasites [10].The only enzyme known to catalyze a...

Tài liệu Báo cáo khoa học: Metabolic control of mitochondrial properties by adenine nucleotide translocator determines palmitoyl-CoA effects Implications for a mechanism linking obesity and type 2 diabetes pdf

... to acti-vation of AMPK cannot lead to production of ATPbecause of lack of mitochondrial ADP. As AMPK sti-mulates cellular fatty acid uptake [29] and the availab-ility of circulating fatty acids ... P1,P5-di(adenosine-5¢)-pentaphosphate(Ap 5A) as inhibitor of adenylate kinase to preventdepletion of available ATP and ADP and to maintainsteady-state respiration. Instead, we did a theoreticalcalculation ... Furthermore, an imbal-ance in fatty acid metabolism resulting in activation of nonoxidative rather than oxidative pathways andaccumulation of biologically active molecules [e.g.long-chain acyl-CoAs...

Tài liệu Báo cáo khoa học: "The Contribution of Linguistic Features to Automatic Machine Translation Evaluation" docx

... set of met-ric variants at three linguistic levels: lexical, syn-tactic, and semantic. In all cases, translation qual-ity is measured by comparing automatic transla-tions against a set of ... Amigó, Julio Gonzalo, Anselmo Pe nas, andFelisa Verdejo. 2005. QARLA: a Framework forthe Evaluation of Automatic Summarization. InProceedings of the 43rd Annual Meeting of the Asso-ciation ... since correla-tion cofficient against human judges donot reveal details about the advantages anddisadvantages of particular metrics. Wethen use this approach to investigate thebenefits of introducing...

Tài liệu Báo cáo khoa học: "Unsupervised Segmentation of Chinese Text by Use of Branching Entropy" pdf

... Proceedings of the COLING/ACL 2006 Main Conference Poster Sessions, pages 428–435,Sydney, July 2006.c2006 Association for Computational Linguistics428 0.5 1 1.5 ... 4 5 6 7 8entropyoffset429430431432 0 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 1 0.55 0.6 0.65 0.7 0.75 0.8 0.85 0.9 0.95 1recallprecisionBincreaseBordinaryBmax433 0 0.1 0.2 ... 1recallprecisionBincreaseBordinaryBmax433 0 0.1 0.2 0.3 0.4 0.5 0.6 0.7 0.8 0.9 1 10 100 1000 10000 100000 1e+06size(KB)recallprecision434...

Tài liệu Báo cáo khoa học: "The Use of Ooject-Special Knowledge in Natural Language Processing" doc

... initial analysis nave been considered, the process which attempts to find causal connections between conceptualizations is activated, in this particular case, the analyzer has already indicated ... wants to take control of (and ultimately make use of) whatever it is that Is output from that SOURCE. In CD, this is expressed by a template for an ATRANS (abstract transfer) of ... CONSUMER of liquids, and a mailbox ts a CONSUMER of mail. Some objects are both SOURCEs and CONSUMERS. A pipe is a CONSUMER of tobacco and a SOURCE of smoke. An Ice cube tray Is a CONSUMER...

Tài liệu Báo cáo khoa học: "THE REPRESENTATION OF INCONSISTENT INFORMATION IN A DYNAMIC MODEL-THEORETIC SEMANTICS" ppt

... Dynamic model-theoretic semantics allows the evaluation of a formula to cause the addition of information to the model. This interaction of the evaluation of a formula and the expansion of ... semantics provides a computationally attractive means of representing the semantics of natural language. However, the models used in this formalism are static and are usually infinite. Dynamic ... models are incomplete models that include only the information needed for an application and to which information can be added. Dynamic models are basically approximations of larger conventional...

Tài liệu Báo cáo khoa học: "Automatic Detection of Nonreferential It in Spoken Multi-Party Dialog" doc

... .58Table 1: Classification of it by two annotators in a corpus subset.4 Automatic Classification4.1 Training and Test Data Generation4.1.1 SegmentationWe extracted all instances of it and the ... shallow feature generation meth-ods could propagate into the model that waslearned from the data. The advantage of this ap-proach is, however, that training and test data arehomogeneous. A ... of the classnonreferential. The overall classification accuracywas 75.1%.The advantage of using a machine learning sys-4http://www.cs.waikato.ac.nz/ ml/tem that produces human-readable models...

Báo cáo khoa học: Heterologous synthesis of cytochrome c¢ by Escherichia coli is not dependent on the System I cytochrome c biogenesis machinery ppt

... mkriamitaltlcaaaahaDALKPEDKVKFRQAS mkhvlastaaglmalgl-assaiaAGLSPEEQIETRQAGmkklstlaalacmtvgsll-atsaqaQFAKPEDAVKYRQSA mrrvllatlmaalpaaaMAADAEHVVEARKGY(1) H. thermoluteolus(2) A. vinosum(3) A. ... FSLVALEFGPLAAM-AKGEMPYDAAAAKAHASDLVTLTKYDPSDLYAPGTSAD-DVKGTALKENFFQEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEEVKPEFFQNMEDVGKIAREFVGAANTLAEVAATGEAEAVKTAFGDVGAACKSCHEKYRAK-ARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKKAKAAIWQDADGFQAKGMAFFEAVAALEPAAGAGQKE-LAAAVGKVGGTCKSCHDDFRVKR* ... FSLVALEFGPLAAM-AKGEMPYDAAAAKAHASDLVTLTKYDPSDLYAPGTSAD-DVKGTALKENFFQEQDEVRKIATNFVEQANKLAEVAAMGDKDEIKAQFGEVGKACKACHEKFREEEVKPEFFQNMEDVGKIAREFVGAANTLAEVAATGEAEAVKTAFGDVGAACKSCHEKYRAK-ARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYRKKKAKAAIWQDADGFQAKGMAFFEAVAALEPAAGAGQKE-LAAAVGKVGGTCKSCHDDFRVKR* ** * ** * * *Fig. 2. Multiple sequence analysis of biochemically characterized...

Xem thêm

Từ khóa: báo cáo khoa học mẫu báo cáo khoa học y học báo cáo khoa học sinh học báo cáo khoa học nông nghiệp báo cáo khoa học lâm nghiệp Nghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thống Nghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt nam Một số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTP đề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giải Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit ĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN ĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDE Quản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninh Phối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọ Nghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùng Nghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chế Định tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Thiết kế và chế tạo mô hình biến tần (inverter) cho máy điều hòa không khí Chuong 2 nhận dạng rui ro Kiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘI HIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀM QUẢN LÝ VÀ TÁI CHẾ NHỰA Ở HOA KỲ