Báo cáo khoa học: A simple in vivo assay for measuring the efﬁciency of gene length-dependent processes in yeast mRNA biogenesis doc

... The Authors Journal compilation ª 2006 FEBS 769 A simple in vivo assay for measuring the efﬁciency of gene length-dependent processes in yeast mRNA biogenesis Macarena Morillo-Huesca, Manuela Vanti ... (2001) Mutations in the TATA-binding pro-tein, affecting transcriptional activation, showsynthetic lethality with the TAF145 gene lacking the TAF N-terminal domain in Saccharomyces cerevisiae.J ... GAL1pr::PHO5-LAC4 for the following assays. The mRNA ratios cal-culated for these two transcription units in the spt4Dstrain and in the isogenic wild type conﬁrmed again the validity of the GLAM ratio to...

Báo cáo khoa học: " A simple pattern-matching algorithm for recovering empty nodes and their antecedents∗" pot

... visit-ing all of the subtrees of the tree concerned. It canalso be regarded as a kind of tree transformation, so the overall system architecture (including the parser)is an instance of the “transform-detransform” ... displayed in Figure 1.accuracy of transitivity labelling was not systemati-cally evaluated here.2.2 Patterns and matchingsInformally, patterns are minimal connected treefragments containing an ... showed that es-timating count values in a similar manner to the way in which match values are estimated reduces the al-gorithm’s performance).Finally, we rank all of the remaining patterns....

Báo cáo khoa học: "A Simple, Similarity-based Model for Selectional Preferences" pdf

... require any manually createdlexical resources. In addition, the corpus for computing the similarity metrics can be freelychosen, allowing greater variation in the domain of generalization than a ... isolated compar-isons of the two generalization paradigms thatwe are aware of, Gildea and Jurafsky’s (2002)task-based evaluation has found clustering-based approaches to have better coverage ... choose a particular instantia-tion of the similarity-based model that makesuse of the fact that the two-corpora approachallows us to use diﬀerent notions of “predicate”and “argument” in the...

Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

... [6,8,27] or toany other sequences available in FASTA and BLASTdatabase programs at the DNA Data Bank of Jap an.Recently, we reported the cloning and s equencing of the gene encoding 4-amino-3-hydroxybenzoate ... enzyme assay revealed the mechanism of the deamination reactionand the subsequent metabolism, including the deaminationstep. The product formed from 4-amino-3-hydroxybenzoicacid by the action of ... and2-aminomuconic acid in the modiﬁed meta-cleavage path-way (Fig. 1B). The 2-aminomuconate deaminase from s trainAP-3 and that from strain JS45 have been puriﬁed andcharacterized in detail [5,6]. The nucleotide...

Báo cáo khoa học: A simple protocol to study blue copper proteins by NMR pot

... for the analysis of all NMR spectra.Theory A classical approach toward structure determination in a paramagnetic metalloprotein does not provide information in the proximity of the metal center ... summarizes the information obtained usingmodified CBCA(CO)NH and CBCANH.Assignment of fast relaxing signals The assignment of the new signals found in the tailored1H-15N HSQC can be performed ... on the neighborhood of a paramagnetic center without requi-ring a specific expertise in the field. The resulting 3D spectraare standard spectra that can be handled by any standardsoftware for...

Báo cáo khoa học: "A Class-Based Agreement Model for Generating Accurately Inﬂected Translations" pptx

... The inputs are a translationhypothesiseI1, an indexndistinguishing the preﬁxfrom the attachment, and a ﬂag indicating if theirconcatenation is a goal hypothesis. The beam search maintains ... English-Arabic translation asan example of a translation direction that expressessubstantially more morphological information in the target. These relations are best captured in a target-side ... pronoun-antecedent. In somelanguages, agreement a ects the surface forms of the words. For example, from the perspective of gener-ative grammatical theory, the lexicon entry for the Arabic nominal‘the...

Báo cáo khoa học: "A Simple Measure to Assess Non-response" docx

... higherthan the sum resulting from the scores of incorrectanswers. This could explain the little success of thismeasure for evaluating QA systems in favor, again, of accuracy measure.Accuracy is the ... technologies(Pe˜nas et al., 2007). The starting point was the re-formulation of Answer Validation as a RecognizingTextual Entailment problem, under the assumptionthat hypotheses can be automatically generated ... Tetsuya Sakai. 200 7a. On the Reliability of FactoidQuestion Answering Evaluation. ACM Trans. AsianLang. Inf. Process., 6(1).Tetsuya Sakai. 2007b. On the reliability of informationretrieval metrics...

Báo cáo khoa học: "A Probabilistic Context-free Grammar for Disambiguation in Morphological Parsing" pdf

... onverdraagzaam (intoler- ant) and, finally, nominal suffixation yields the noun onverdraagzaamheid (intolerance): (7) N A A\N A/ A A heid on V V \A V/V V zaam I I ver draag Also, the ... appropriateness of the training set: for one thing, it must have a reasonable size and be representative of the domain that is being modelled. Our training set was the CELEX database which contains ... AB may, according to the Right-Hand Head Rule be combined into a word of category B 4. In addition to this general rule for com- pounding, the grammar contains a small set of rules defining...

Báo cáo khoa học: "A SIMPLE BUT USEFUL APPROACH TO CONJUNCT IDENTIFICATION" docx

... exploring the automation of extraction of information from structured reference manuals. The largest manual available to the project in machine-readable form is the Merck Veterinary Manual, ... noun phrase is the label associated with the head noun of the noun phrase. In some instances, a preceding adjective influences the case label of the noun phrase, as, for example, when an adjective ... queried about the information contained in the text of the manual. This paper primarily discusses the conjunct identifier for coordinate conjunctions. Detailed information about the other components...

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... the synthesis of thermozeaxanthins andthermobiszeaxanthins, which are the main carotenoids of T. thermophilus [15]. The insertion of thermozeax-anthins and thermobiszeaxanthins into the cell ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... electron acceptor, at 25 °C and atpH 7.4 in the presence of NADH as well as NADPH, the Kmvalue of the FNR for NADPH was about600-fold lower than that for NADH, and the Vmaxvalue of the FNR...

Xem thêm