0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Báo cáo khoa học: A novel ErbB2 epitope targeted by human antitumor immunoagents ppt

Báo cáo khoa học: A novel ErbB2 epitope targeted by human antitumor immunoagents ppt

Báo cáo khoa học: A novel ErbB2 epitope targeted by human antitumor immunoagents ppt

... extracellular domain of ErbB2 receptor; EDIA, Erbicin-derived immunoagent; ERB-hcAb, human compact antibody against ErbB2; ERB-hRNase, human anti -ErbB2 immunoRNase with Erbicin fused to human pancreatic ... FEBS ErbB2, termed Erbicin [7], with either a human RNaseor the Fc region of a human IgG1, called Erb-hRNaseand human compact antibody against ErbB2 (Erb-hcAb), respectively. Both immunoagents ... both ErbB2- positivecells and soluble purified ErbB2 antigen with apparentaffinity values in the namomolar range, as determined by ELISA, surface plasmon resonance, and isothermaltitration calorimetry...
  • 11
  • 373
  • 0
Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

... CumOOH, and NADPHwere also obtained from Sigma. Sephadex G-25 was pur-chased from Pharmacia (Uppsala, Sweden). All the othermaterials were of analytical grade and obtained fromBeijing Chemical ... ascorbate-treatedmitochondria was analyzed by thiobarbituric acid assay[34]. In this assay, thiobarbituric acid reacts with malonal-dehyde and ⁄ or other carbonyl by- products of free-radical-mediated ... such asinstability, antigenicity and poor availability, muchattention has been paid to its artificial imitation [9,10].In synthetic approaches, an initial attempt is madeto synthesize organoselenium...
  • 9
  • 491
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "A Novel Approach to Semantic Indexing Based on Concept" ppt

... a sample texteach lexical chain is regarded as a concept that ex-presses the meaning of a document. Therefore, eachconcept was extracted by lexical chains.For example, Figure 1 shows a sample ... information ra-tio rather than information quantity as the semanticweight of indexes. This approach has an advantagein that we need not consider document length whenindexing because the overall ... exercise, wasrated for each text. The score that was rated by sixsubjects is normalized as an average.The results of manually extracted index terms andtheir weights are given in Table 1. The...
  • 6
  • 348
  • 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... purchased from Toyobo (Osaka, Japan). Emul-gen 911 was a gift from Kao Chemical (Tokyo, Japan).NADPH, NADH and NADP+were purchased fromOriental Yeast (Tokyo, Japan). a- Cyano-4-hydroxycinnamicacid ... 106 NAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKA-EFQGK-RVLIVGGGDS 163E. coli 103 -EYTCDALIIATGASA RYLGLPSEEAFKGRGVSACATCDG-FFYRNQKVAVIGGGNT 157 A. pernix 115 LEVKARTVILAVGSRR RKLGVPGEAELAGRGVSYCSVCDAPLFKGKDAVVVVGGGDS...
  • 14
  • 617
  • 0
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

... (sense) and5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primersfor unmethylated DNA were: 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCTACTT-3¢ (antisense).Caspase 3 activityCells ... intensity was determined using imagemaster2d elite software 4.01 (Amersham Bioscience, Uppsala,Sweden).Statistical analysisData in bar graphs are expressed as the mean and standarddeviation of ... caspase assay were seeded on a 24-well plate and transfected with FuGENE 6. The caspaseassay was performed using the CaspACE colorimetric assaykit as described by the manufacturer (Promega)....
  • 12
  • 613
  • 0
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

... vulgaris).Biochem J 387, 85–91.25 Kanda A, Takahashi T, Satake H & Minakata H (2006)Molecular and functional characterization of a novel gonadotropin-releasing-hormone receptor isolated ... 8,459–467.10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K &Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland ofthe common octopus Octopus vulgaris. ... & Minakata H (2003)Insight into tachykinin-related peptides, their receptors,and invertebrate tachykinins: a review. Zool Sci 5,533–549.7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy-ama...
  • 11
  • 595
  • 0
Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

... carbohydratebackbone, was carried out by mild hydrazinolysis (de-O-acylation) followed by de-N-acylation using hot KOH. Thelipo-oligosaccharide was also analyzed after acid treatment,attained by mild ... Gram-negative bacteria, and their adaptability tomany different pollutants [1].Pseudomonas stutzeri OX1 is a Gram-negative bacteriumisolated from the activated sludge of a wastewater treatmentplant, ... Viviana Izzo2, Alba Silipo1, Luisa Sturiale3, Domenico Garozzo3, Rosa Lanzetta1,Michelangelo Parrilli1, Antonio Molinaro1and Alberto Di Donato21Dipartimento di Chimica Organica...
  • 14
  • 715
  • 0
Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

... (Osaka, Japan); meatextract (Extract Ehlrich) w as from Kyokuto Seiyaku Kogyo(Osaka, Japan); and pentafluorophenylhydrazine was fromPfaltz & Bauer. (Waterbury, CT, USA). DE52 cellulose wasfrom ... only as a carbon source, but also as a nitrogensource for g rowth of the assimilating bacteria. Deaminases,which catalyze the release of ammonia, are a key enzyme inthe metabolic pathways of ... Decarboxylation has a concertedmechanism with an aromatic t ransition state. 2-hydroxy-5-carboxymuconic 6 -semialdehyde has an aldehyde groupand a C-5 carboxyl group, which is a 3-ketoacid. As...
  • 7
  • 613
  • 1
Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt

Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt

... man-made organic compounds, among them thetobacco alkaloid nicotine. Perhaps analysed in greatestdetail is the pathway of nicotine degradation as it takesplace in Arthrobacter nicotinovorans ... c-N-methylamino-butyrate oxidase; megaplasmid pAO1; nicotine degradation;sarcosine o xidase.The bacterial soil community plays a pivotal role in thebiodegradation of a n a lmost unlimited spectrum of naturaland ... oxidase (MABO). (A) M ABO analysed b y PAGE on nondena-turing 10% (w/v) polyacrylamide gels and stained with Coomassiebrillant blue (lane 1), or analysed by activity staining withc-N-methylaminobutyrate...
  • 8
  • 647
  • 0
Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "A Novel Feature-based Approach to Chinese Entity Relation Extraction" ppt

... tree-kernel approaches are not suitable for Chinese, at least at current stage. In this paper, we study a feature-based approach that basically integrates entity related information with context ... extraction has been extensively studied in English over the past years. It is typically cast as a classification problem. Existing approaches include feature-based and kernel-based classification. ... are used as feature, and a classifier is trained for each relation type and subtype; (2) similar to (1) but all nine structures are concerned; and (3) similar to (2) but the training data...
  • 4
  • 479
  • 0

Xem thêm

Từ khóa: báo cáo khoa họcbáo cáo khoa học mẫubáo cáo khoa học y họcbáo cáo khoa học sinh họcbáo cáo khoa học nông nghiệpbáo cáo khoa học lâm nghiệpbáo cáo khoa học thủy sảnbáo cáo khoa học về cá trabáo cáo khoa học nghiên cứu chôm chômtrạng thái hiện sinh báo cáo khoa họcbiểu tượng văn học báo cáo khoa họctài liệu báo cáo khoa họccách trình bày báo cáo khoa họcbáo cáo khoa học toán họccách làm báo cáo khoa họcBáo cáo quy trình mua hàng CT CP Công Nghệ NPVchuyên đề điện xoay chiều theo dạngNghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANPhát hiện xâm nhập dựa trên thuật toán k meansThơ nôm tứ tuyệt trào phúng hồ xuân hươngChuong 2 nhận dạng rui roTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Nguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namHIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀMTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ