Tài liệu Báo cáo Y học: Characterization and regulation of y

Tài liệu Báo cáo Y học: Characterization and regulation of yeast Ca2+-dependent phosphatidylethanolamine-phospholipase D activity docx

... membrane- bound PtdEtn-PLD activity. Cytosolic and membrane-bound fractions were prepared as described in Materials and methods. PtdEtn-PLD activity measured without addition of EDTA, EGTA and any divalent cations ... characterized the cytosolic and membrane-bound forms of yeast PtdEtn-PLD and examined the regulation of PtdEtn-PLD activity under certain growth, nutrit...

Ngày tải lên : 22/02/2014, 07:20

10
499
0

Tài liệu Báo cáo Y học: Presence and regulation of the endocannabinoid system in human dendritic cells potx

... response played by dendritic cells, nothing is known about their capability to produce, respond to and degrade endocanna- binoids. Indeed as dendritic cells can be derived from monocytes, and as monocytes ... macrophages and lymphocytes are able to produce a higher amount of anandamide and/ or 2-AG [21,23–26]. IgE-dependent stim- ulation of RBL-2H3 cells also leads to the formation...

Ngày tải lên : 22/02/2014, 07:20

8
645
0

Tài liệu Báo cáo khoa học: Characterization and mode of action of an exopolygalacturonase from the hyperthermophilic bacterium Thermotoga maritima doc

... into lyases (b-elimination) and hydrolases [2]. All hydrolases involved in degradation of pectin are classiﬁed as members of family 28 of the glycoside hydrolases, including the endopolygalacturonases, ... :(140) FDSRPAFTAAIAACNAAGGGRVVVPAGN WYCAGPIVLLSHVHFHLGADCTIYFSPNPDDYAKDGPVDCGTNGKLYYSRWQS : 182 Thther (?) :(192)-SSGTLNTAAIQKAIDKCPD GGVVLVPAGK IFVTGPIHLKSNMTLDVEG TLLGTTDPDQYPNPYD...

Ngày tải lên : 20/02/2014, 03:20

10
592
0

Tài liệu Báo cáo khoa học: miRNAs and regulation of cell signaling pptx

... addition, miR-34c is induced under the control of both p53 and p38-MAPK, and prevents Myc-dependent DNA replication by targeting c-Myc [23]. Kawashima et al. [24] reported that brain-derived neurotrophic ... autoregulatory loop mediated by miR-21 and PDCD4 controls the AP-1 activity in RAS transforma- tion. Oncogene 28, 73–84. 65 Klein ME, Lioy DT, Ma L, Impey S, Mandel G & Good...

Ngày tải lên : 14/02/2014, 19:20

9
684
0

Tài liệu Báo cáo Y học: Characterization of an omega-class glutathione S-transferase from Schistosoma mansoni with glutaredoxin-like dehydroascorbate reductase and thiol transferase activities pptx

... 0.02 7-Chloro-4-nitrobenzo-2-oxa- 1,3-diazole ND Ethacrynic acid 0.02 p-Nitrobenzyl chloride ND Vinylene trithiocarbonate ND t-Butyl hydroquinone ND p-Chloranil ND Dehydroascorbate 0.20 Hydroxyethyl disulﬁde 0.11 Table ... to bind S-hexyl glutathione matrix and displayed signiﬁcant glutathione-dependent dehydroascorbate reductase and thiol transferase enzymatic activities. Keywords: gluta...

Ngày tải lên : 21/02/2014, 01:21

10
638
0

Tài liệu Báo cáo Y học: Expression and characterization of active site mutants of hevamine, a chitinase from the rubber tree Hevea brasiliensis docx

... sufﬁciently high, we decided to refold these inclusion bodies. The procedure yielded pure protein as judged by SDS/ PAGE. The activity of the pure recombinant protein was 80% of that of t he wild-type ... maximum activity at pH 2.0–3.0. Enzyme activity decreases rapidly at pH 5.0 and above. At pH 8.0 and above, there is n o activity remaining. A n Table 2. Statistics of da...

Ngày tải lên : 22/02/2014, 04:20

9
616
0

Tài liệu Báo cáo Y học: Structural and biochemical characterization of neuronal calretinin domain I– II (residues 1– 100) Comparison to homologous calbindin D28k domain I–II (residues 1 –93) pdf

... fusion products. Individual synthetic Calb EF-hands I, III, IVand V bind calcium [29]. This data of A ˚ kerfeldt et al. [29] agrees with the large body of independent data collected on Calb and truncated Calbs ... (h) and other amino acids (.), the calcium-binding ligands are designated by their coordinates: x, y, z, -y, -x and -z [60]. Residues discussed in the text are given in...

Ngày tải lên : 22/02/2014, 07:20

9
648
0

Tài liệu Báo cáo Y học: Dnmt3a and Dnmt1 functionally cooperate during de novo methylation of DNA pdf

... cooperation of Dnmt1 and Dnmt3a. Puriﬁed Dnmt1 and Dnmt3a enzymes were employed to methylate a 958mer PCR product using labeled [methyl- 3 H]-S-adeno- sylmethionine. We performed a series of three methylation reactions, ... cooperation of Dnmt3a and Dnmt1 in de novo methylation of DNA that can only be provided by in vitro experiments. In this model Dnmt3a is targeted to a domain...

Ngày tải lên : 21/02/2014, 01:21

4
526
0

Tài liệu Báo cáo Y học: Characterization of a cloned subtilisin-like serine proteinase from a psychrotrophic Vibrio species doc

... of the catalytic triad are indicated by an asterisk. Secondary structural elements based on known crystal structures of PRK are indicated by h (helix) and s (strand) and calcium binding ligands (P175, ... Cys67–Cys99 and Cys163– Cys194 (numbering of VPR from the N-terminal of the proteinase domain (see Fig. 2 or 3). The proteinase domain of VPR additionally contains Cys277 an...

Ngày tải lên : 21/02/2014, 01:21

11
550
0

Tài liệu Báo cáo Y học: DNA and RNA damage by Cu(II)-amikacin complex docx

... semisynthetic aminoglycoside, a derivative of kanamycin A, having the B1 amino group of 2-deoxystreptamine moiety modiﬁed by acylation with 4-amino-2-hydroxybutyric acid. Previous studies demon- strated ... reagents: boric acid, acrylamide, bis-acrylamide and urea were obtained from Serva (Heidelberg, Germany). Decomposition of dG and formation of 8-oxo-dG Solutions of dG (50 l...

Ngày tải lên : 21/02/2014, 01:21

10
503
1