Tài liệu Báo cáo khoa học: "Paraphrasing Using Given and New

Tài liệu Báo cáo khoa học: "Paraphrasing Using Given and New Information in a Question-Answer System" docx

... role of given and new information in formulating a paraphrase that differs in a meaningful way from the user's question. A description is also given of the transformational grammar used ... Paraphrasing Using Given and New Information in a Question-Answer System Kathleen R. McKeown Department of Computer and Information Science The Moore Scho...

Ngày tải lên : 21/02/2014, 20:20

6
532
0

Tài liệu Báo cáo khoa học: ATP-dependent modulation and autophosphorylation of rapeseed 2-Cys peroxiredoxin docx

... vector] as 5¢-primer and 5¢-TCTCCGTAGG GGAGACAAAAGT-3¢,5¢-ATCCCGCGGGGGAAACCT CATC-3¢ and 5¢-CTGTTTGGAC GAACGCAAGATG-3¢ as 3¢-primers for C53S, C175S and W88F variants, respec- tively (mutated codons ... peroxiredoxin Martin Aran 1 , Daniel Caporaletti 1 , Alejandro M. Senn 1 , Marı a T. Tellez de In ˜ on 2 , Marı a R. Girotti 1 , Andrea S. Llera 1 and Ricardo A. Wolosiuk 1 1 In...

Ngày tải lên : 18/02/2014, 17:20

14
460
0

Tài liệu Báo cáo khoa học: "Hand-held Scanner and Translation Software for non-Native Readers" docx

... printed (ie. off-line) material in foreign languages. It consists of a hand-held scanner and sophisticated parsing and translation software to provide readers a limited number of translations selected ... for all languages. TwicPen has been designed to overcome these shortcomings and intends to provide readers of printed material with the same kind and quality of terminological...

Ngày tải lên : 20/02/2014, 12:20

4
339
0

Tài liệu Báo cáo khoa học: "Integration of Large-Scale Linguistic Resources in a Natural Language Understanding System" pdf

... semantic analysis, and pragmatic analysis. Each stage has been designed to use linguistic data such as the lexicon and grammar, which are maintained separately from the engine, and can easily ... resources into our natural language understanding system. Client- server architecture was used to make a large volume of lexical information and a large knowledge base available...

Ngày tải lên : 20/02/2014, 18:20

5
416
0

Tài liệu Báo cáo khoa học: "Matching Readers’ Preferences and Reading Skills with Appropriate Web Texts" docx

... retrieval system (Collins-Thompson and Callan, 2004) is based on web data that have been annotated and indexed off-line. Also, relatedly, (Schwarm and Ostendorf, 2005) use a statistical language ... coherence (e.g.,(Miltsakaki and Kukich, 2004), (Barzilay and Lapata, 2008), (Bruss et al., 2004), (Pitler and Nenkova, 2008)) can also be integrated after psy- cholinguistic evaluati...

Ngày tải lên : 22/02/2014, 02:20

4
330
0

Tài liệu Báo cáo khoa học: "Extracting Comparative Entities and Predicates from Texts Using Comparative Type Classification" pptx

... types. Mining comparative entities and predicates (Task 2): Our basic idea for the second task is selecting candidates first and finding answers from the candidates later. We regard each of ... defining the syntax and semantics of comparative constructs. Ha (199 9a; 1999b) classified the structures of Korean comparative sentences into several classes and arranged comparison-b...

Ngày tải lên : 20/02/2014, 04:20

9
405
0

Tài liệu Báo cáo khoa học: "Joint Word Segmentation and POS Tagging using a Single Perceptron" docx

... c 11 tag t on a word containing char c (not the starting or ending character) 12 tag t on a word starting with char c 0 and containing char c 13 tag t on a word ending with char c 0 and containing ... incrementally. At each stage, the incoming character is combined with ex- isting partial candidates in all possible ways to gen- erate new partial candidates. An agenda is used to...

Ngày tải lên : 20/02/2014, 09:20

9
576
0

Tài liệu Báo cáo khoa học: Hypothalamic malonyl-CoA and CPT1c in the treatment of obesity pptx

... increase in malonyl-CoA promotes a decrease in neuropeptide Y and agouti related peptide in hypothalamic malonyl-CoA while promoting an increase in proopiomelanocortin and cocaine and amphetamine regulated ... [41–45]. There are at least six carnitine acyltransferases in mammals [46]. Carnitine acetyltransferase and carnitine octonyltransferase mediate the transfer of...

Ngày tải lên : 14/02/2014, 22:20

7
678
0

Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

... was shown that the broad-complex, tramtrack and bric -a- brac domain containing protein KCTD1 directly binds to AP- 2a and acts as a negative regulator for AP- 2a trans- activation [34]. It was also ... RRDYHSVRRPDVLLHSAHHG Gamma QQAWPGRQSQEGAGLPSHHGRPAGLLPHLSG-LEAGAVSARRDAY RRSDLLLPHAHAL Epsilon QAAWAAPRAAARAHEE PPGLLAPPARALG-LDP RRDYA TAVPRLLHGLADG Delta IHHGEPTDFINLHNARALKSSCLDE...

Ngày tải lên : 16/02/2014, 09:20

9
642
0

Tài liệu Báo cáo khoa học: X-ray crystallographic and NMR studies of pantothenate synthetase provide insights into the mechanism of homotropic inhibition by pantoate docx

... structure of A. thaliana PS (Fig. S5 and Table S1) shows that it has a large loop at the dimer interface and fewer energetically favorable N-terminal and C-terminal interdomain interactions, such as the ... substrate binding. His106 is involved in intersubunit interactions via its side chain, and is in a similar position to Glu132 in A. thaliana PS. Val111 and Gly113, on...

Ngày tải lên : 16/02/2014, 09:20

16
791
0