0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high specific activity from Pisum sativum catalytically translocates in the 3¢fi5¢ direction docx

Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high specific activity from Pisum sativum catalytically translocates in the 3¢fi5¢ direction docx

Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high specific activity from Pisum sativum catalytically translocates in the 3¢fi5¢ direction docx

... VI)showed a linear rate up to 30 min (Fig. 4A) . After furtherincubation it deviated from the linearity and becamesaturated at  60 min. Titration of helicase activity with increasing amounts of the ... helicase activity isdefined as the amount of enzyme that unwinds 30% of the DNA helicase substrate at 37 °Cin30min(1 %in one min). For examining the effect of DNA- interactingcompounds on DNA unwinding ... activity from Pisum sativum catalytically translocates in the 3¢fi5¢ direction Tuan-Nghia Phan, Nasreen Z. Ehtesham, Renu Tuteja and Narendra TutejaInternational Centre for Genetic Engineering and...
  • 11
  • 573
  • 0
Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

... absorbance indicated an increase in mito-chondrial swelling and a decrease in mitochondria integrity.TBARS content in ferrous sulfate ⁄ ascorbate-treatedmitochondria was analyzed by thiobarbituric acid ... whereas that for the damagegroup decreasede considerably over time, indicatingthat mitochondrial swelling was increased. However, the swelling in the protection group, which contained a certain ... such asinstability, antigenicity and poor availability, muchattention has been paid to its artificial imitation [9,10]. In synthetic approaches, an initial attempt is madeto synthesize organoselenium...
  • 9
  • 491
  • 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... the synthesis of thermozeaxanthins andthermobiszeaxanthins, which are the main carotenoidsof T. thermophilus [15]. The insertion of thermozeax-anthins and thermobiszeaxanthins into the cell ... FNR from Azotobacter vinelandii, ZP_00417949; FNR from Rhodobact-er capsulatus, AAF35905; ADR from Homo sapiens, AAB59498; adrenodoxin reductase from Saccharomyces cerevisiae, AAB64812; FprAfrom...
  • 14
  • 617
  • 0
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

... 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primersfor unmethylated DNA were: 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCTACTT-3¢ (antisense).Caspase 3 activity Cells ... subjected to the caspase assay were seeded on a 24-well plate and transfected with FuGENE 6. The caspaseassay was performed using the CaspACE colorimetric assaykit as described by the manufacturer ... Frohman MA (2006) 3¢ EndcDNA amplification using classic RACE. Nat Protoc 1,2742–2745.29 Szpaderska AM & Frankfater A (2001) An intracellularform of cathepsin B contributes to invasiveness...
  • 12
  • 613
  • 0
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

... evolutionary aspects of invertebrate tachykininand tachykinin-related peptideAtsuhiro Kanda, Kyoko Takuwa-Kuroda, Masato Aoyama and Honoo SatakeSuntory Institute for Bioorganic Research, Osaka, JapanTachykinins ... into tachykinin-related peptides, their receptors,and invertebrate tachykinins: a review. Zool Sci 5,533–549.7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy-ama M, Minakata H, Chiba T, Metoki ... 8,459–467.10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K &Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland of the common octopus Octopus vulgaris....
  • 11
  • 595
  • 0
Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

... Thomas-Oates, J.E. & Brade, H. (1994) Preparationand structural analysis of oligosaccharide monophosphatesobtained from the lipopolysaccharide of recombinant strains ofSalmonella minnesota ... KOH. The lipo-oligosaccharide was also analyzed after acid treatment,attained by mild hydrolysis with acetic acid, to obtaininformation on the nature of the phosphate and acyl groups. The two ... OX1 is a Gram-negative bacteriumisolated from the activated sludge of a wastewater treatmentplant, and endowed with unusual metabolic capabilities for the degradation of aromatic hydrocarbons...
  • 14
  • 715
  • 0
Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

... and2-aminomuconic acid in the modified meta-cleavage path-way (Fig. 1B). The 2-aminomuconate deaminase from s trainAP-3 and that from strain JS45 have been purified andcharacterized in detail [5,6]. The nucleotide ... [6,8,27] or toany other sequences available in FASTA and BLASTdatabase programs at the DNA Data Bank of Jap an.Recently, we reported the cloning and s equencing of the gene encoding 4-amino-3-hydroxybenzoate ... 6-semialdehyde deami-nase, is a new type of deaminase that differs from the 2-aminomuconate deaminases reported previously in thatit primarily and specifically attacks 2-amino-5-carboxymu-conic 6-semialdehyde....
  • 7
  • 613
  • 1
Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt

Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt

... A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine byArthrobacternicotinovoranspAO1Calin B. Chiribau1, Cristinel Sandu1, ... of a n a lmost unlimited spectrum of naturaland man-made organic compounds, among them the tobacco alkaloid nicotine. Perhaps analysed in greatestdetail is the pathway of nicotine degradation ... b y PAGE on nondena-turing 10% (w/v) polyacrylamide gels and stained with Coomassiebrillant blue (lane 1), or analysed by activity staining with c-N-methylaminobutyrate as a substrate (lane...
  • 8
  • 647
  • 0
Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "A Novel Feature-based Approach to Chinese Entity Relation Extraction" ppt

... least at current stage. In this paper, we study a feature-based approach that basically integrates entity related information with context information. 3.1 Classification Features The classification ... insufficient training data. Intuitively we can follow the path of “Nested ⇒ Adjacent ⇒ Separated ⇒ Others” (Nested, Adjacent and Separated structures are majority in the corpus) to perform the inference. ... both internal and external context. Internal context includes the characters inside two entities and the characters inside the heads of two entities. External context involves the characters around...
  • 4
  • 479
  • 0
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor docx

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor docx

... DDBJ/EMBL/GenBankdatabases under accession number AB081457.Intron 1CGACAGgtgagt)3069 bpÀcaacagGTATATIntron 2 TTTTGTgtaaat)146 bpÀcaacagGTATAAIntron 3 AGACGGgtatga)469 bpÀtttcagGTAGTGIntron 4 TGCCAGgtatgt)119 ... followed by dA-tailing of the cDNA using dATP and terminal transferase (Roche). The first cDNA was amplified using an oligo-dT anchor primerand a gene -specific primer (5¢-GTGAACTTGCAGAATGGTAGCTCG-3¢; ... sequenceincluding the transmembrane domains and intracellular andextracellular regions displayed high identity to those ofmammalian tachykinin receptors and insect tachykinin-related peptide...
  • 9
  • 472
  • 0

Xem thêm

Từ khóa: tài liệu báo cáo khoa học bản chất của khủng hoảng kinh tế thế giới pdftài liệu báo cáo nghiên cứu khoa họctài liệu về báo cáo khoa họcbáo cáo khoa học công nghệ phục vụ nông nghiệp và phát triển nông thôn các tỉnh phía bắc 2006 2007 tài liệu phục vụ hội nghịbáo cáo khoa học tài chính côngbáo cáo khoa học số loài quý hiếm tại vườn quốc gia ba bểBáo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018Nghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namMột số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTPđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhTrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Phát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ longPhát hiện xâm nhập dựa trên thuật toán k meansĐịnh tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)Chiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015TÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ