0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Tài liệu Báo cáo khoa học: Transcription of individual tRNA1Gly genes from within a multigene family is regulated by transcription factor TFIIIB pdf

Tài liệu Báo cáo khoa học: Transcription of individual tRNA1Gly genes from within a multigene family is regulated by transcription factor TFIIIB pdf

Tài liệu Báo cáo khoa học: Transcription of individual tRNA1Gly genes from within a multigene family is regulated by transcription factor TFIIIB pdf

... shut off. By contrast, when there is demand forlarge excesses of a particular type of tRNA, as in thePSG, and sufficient quantities of transcription factorsare available, transcription from all ... transcription FEBS Journal 272 (2005) 5191–5205 ª 2005 FEBS 5205 Transcription of individual tRNAGly1 genes from within a multigene family is regulated by transcription factor TFIIIB Akhila ... sequestration of TFIIIB. Availability of the transcription factor TFIIIB in excess could serve as a general mechanism to initiate tran-scription from all the individual members of the gene family as...
  • 15
  • 484
  • 0
Báo cáo khoa học: Expression of the Drosophila melanogaster ATP synthase a subunit gene is regulated by a transcriptional element containing GAF and Adf-1 binding sites pptx

Báo cáo khoa học: Expression of the Drosophila melanogaster ATP synthase a subunit gene is regulated by a transcriptional element containing GAF and Adf-1 binding sites pptx

... 4013Expression of theDrosophila melanogasterATP synthase a subunitgene is regulated by a transcriptional element containing GAFand Adf-1 binding sitesAna Talamillo1,*, Miguel Angel Ferna´ndez-Moreno1, ... synthase and inparticular the a- F1-ATPase and b-F1-ATPase catalyticsubunits have been often used as markers for mitochondrialbiogenesis [6,31,44,45]. The Drosophila a- F1-ATPase gene is organized ... PCR from total DNA using theprimers pADm1 (forward; 5¢-AGCAGTCGACGAAGCGACGAAGTGAAGCTGCGTGA-3¢) and pADm3(reverse; 5¢ -A TCCGTCGACATGCTTTTTAACTGTTCG-3¢). After d igestion with SalI (which...
  • 11
  • 532
  • 0
Tài liệu Báo cáo khoa học: Characterization of electrogenic bromosulfophthalein transport in carnation petal microsomes and its inhibition by antibodies against bilitranslocase docx

Tài liệu Báo cáo khoa học: Characterization of electrogenic bromosulfophthalein transport in carnation petal microsomes and its inhibition by antibodies against bilitranslocase docx

... (1992) Spatial organization of enzymes in plant metabolic pathways. Annu RevPlant Physiol Plant Mol Biol 43, 241–267.4 Fujiwara H, Tanaka Y, Yonekura-Sakakibara K, Fuku-chi-Mizutani M, Nakao M, ... legitimate to apply theScrutton and Utter equation [40] to the inhibition data.Data analysesData were analysed by means of sigmaplot 2001 (SPSSScience Software Gmbh, Erkrath, Germany). Data for ... 1135–1149.22 Kitamura S, Shikazono N & Tanaka A (2004) TRANS-PARENT TESTA 19 is involved in the accumulation of both anthocyanins and proanthocyanidins in Arabi-dopsis. Plant J 37, 104–114.23...
  • 15
  • 589
  • 0
Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "Integration of Large-Scale Linguistic Resources in a Natural Language Understanding System" pdf

... semantic analysis, and pragmatic analysis. Each stage has been designed to use linguistic data such as the lexicon and grammar, which are maintained separately from the engine, and can easily ... Integration of Large-Scale Linguistic Resources in a Natural Language Understanding System Lewis M. Norton, Deborah A. Dahl, Li Li, and Katharine P. Beals Unisys Corporation 2476 Swedesford Road ... into our natural language understanding system. Client- server architecture was used to make a large volume of lexical information and a large knowledge base available to the system at development...
  • 5
  • 416
  • 0
Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

... Analyses of AP- 2a- null mice have demonstrated that AP- 2a is a fundamental regulator of mammalian craniofacialdevelopment. AP- 2a knockout mice die perinatallywith craniofacial defects, thoracoabdominoschisis, ... RRDYHSVRRPDVLLHSAHHG Gamma QQAWPGRQSQEGAGLPSHHGRPAGLLPHLSG-LEAGAVSARRDAY RRSDLLLPHAHAL Epsilon QAAWAAPRAAARAHEE PPGLLAPPARALG-LDP RRDYA TAVPRLLHGLADG Delta IHHGEPTDFINLHNARALKSSCLDEQRRELGCLDAYR RHDLS ... Tainsky MA & Kan-nan P (2000) Characterization of the activation domains of AP-2 family transcription factors. J Biol Chem 275,29701–29708.10 Williams T & Tjian R (1991) Analysis of...
  • 9
  • 642
  • 0
Tài liệu Báo cáo khoa học: Characterization of human deoxyribonuclease I gene (DNASE1) promoters reveals the utilization of two transcription-starting exons and the involvement of Sp1 in its transcriptional regulation ppt

Tài liệu Báo cáo khoa học: Characterization of human deoxyribonuclease I gene (DNASE1) promoters reveals the utilization of two transcription-starting exons and the involvement of Sp1 in its transcriptional regulation ppt

... Journal compilation ª 2006 FEBS6 Shiokawa D & Tanuma S (2001) Characterization of human DNase I family endonucleases and activation of DNase c during apoptosis. Biochemistry 40, 143–152.7 Nadano ... Y, Yamamoto F & Takizawa H(2002) Characterization of the human ABO gene pro-moter in erythroid cell lineage. Vox Sang 82, 39–46.34 Yasuda T, Awazu S, Sato W, Iida R, Tanaka Y &Kishi ... Kawai4, Tamiko Nakajima1, ChikakoMakita1, Masako Itoi1, Yutaka Tajima1, Koichiro Kishi1and Toshihiro Yasuda21 Department of Legal Medicine and Medical Genetics, Gunma University, Japan2...
  • 12
  • 609
  • 0
Tài liệu Báo cáo khoa học: Role of transcription factor activator protein 1 (AP1) in epidermal growth factor-mediated protection against apoptosis induced by a DNA-damaging agent doc

Tài liệu Báo cáo khoa học: Role of transcription factor activator protein 1 (AP1) in epidermal growth factor-mediated protection against apoptosis induced by a DNA-damaging agent doc

... pbabePuro, and J. Takino, M.Tagawa, and K. Uchida for technical assistance. Thiswork was supported in part by a grant from theprogram Grants-in-Aid for Young Scientists of theMinistry of ... Healthcare).Caspase 9 activity assayCaspase 9 activity was examined according to the instruc-tion manual of the Caspase 9 ⁄ Mch6 Fluorometric ProteaseAssay kit (Medical and Biological Laboratories ... 2063–2069.45 Nishina H, Sato H, Suzuki T, Sato M & Iba H (1990)Isolation and characterization of fra-2, an additionalmember of the fos gene family. Proc Natl Acad SciUSA 87, 3619–3623.46 Zerial...
  • 13
  • 493
  • 0
Tài liệu Báo cáo khoa học: Regulation of connective tissue growth factor (CTGF/CCN2) gene transcription and mRNA stability in smooth muscle cells Involvement of RhoA GTPase and p38 MAP kinase and sensitivity to actin dynamics docx

Tài liệu Báo cáo khoa học: Regulation of connective tissue growth factor (CTGF/CCN2) gene transcription and mRNA stability in smooth muscle cells Involvement of RhoA GTPase and p38 MAP kinase and sensitivity to actin dynamics docx

... Sugawara, A. , Mukoyama,M.,Mori,K.,Makino,H.,Suganami, T., Nagae, T ., Yahata , K ., Fujinaga, Y., Tanaka, I . &Nakao, K. (2001) Role of connect ive tissue growth factor inprofibrotic action ... Kawahara, T.,Morishita, T. , Tamakawa, H., Yamagami, K., Inui, J., Maekawa,M. & Narumiya, S. (1997) Calcium sensitization of sm ooth musc lemediated by a Rho-associated protein kinase ... c ofactor for these transcription factors [39]. The exact mechanism by whichRhoA activates these transcription factors is just beginningto be elucidated. In particular, RhoA-mediated SRFactivation...
  • 15
  • 576
  • 0
Tài liệu Báo cáo khoa học: Effect of deletion of the DNase I hypersensitive sites on the transcription of chicken Ig-b gene and on the maintenance of active chromatin state in the Ig-b locus docx

Tài liệu Báo cáo khoa học: Effect of deletion of the DNase I hypersensitive sites on the transcription of chicken Ig-b gene and on the maintenance of active chromatin state in the Ig-b locus docx

... 9210 and image quant (Amersham Bioscienc-es, Piscataway, NJ, USA). Acetylation status of H3 and H4histones was examined by chromatin immunoprecipitation(ChIP) and real-time PCR (R-PCR) as described ... pro-moters and enhancers but also are likely to participatein the establishment and maintenance of an activechromatin state [18,28,29]. In addition to their pres-ence in and adjacent to active ... was determined from these values [31]. Values aremean ± SE. An over-scaled bar is shown by double wavy lines, andits mean value is shown at the left. Bottom; the positions of eighttargets are...
  • 11
  • 638
  • 0
Tài liệu Báo cáo khoa học: Characterization of the promoter for the mouse a3 integrin gene Involvement of the Ets-family of transcription factors in the promoter activity doc

Tài liệu Báo cáo khoa học: Characterization of the promoter for the mouse a3 integrin gene Involvement of the Ets-family of transcription factors in the promoter activity doc

... 5¢-ATGGTACCTGGTGATCCAGGGCTTGC-3¢Sac 5¢-CCGTTCCGAGCTCCGAGCAC-3¢S3 5¢-ATGAGCTCGGGAACCCTTAAAGCCCG-3¢S2 5¢-ATGAGCTCTGCTTTCCTTCCGGGGA-3¢S1 5¢-ATTGAGCTCACCAGGAGGGCAGGAGG-3¢mEts-R* 5¢-GACACCTGTCGGTAACCCTTAAAGCC-3¢mGATA* ... experiments.Mutated bases are underlined.Primer SequenceK4 5¢-GTGGTACCAGTAGCAGCCGCCGCAAG-3¢K3 5¢-ATGGTACCGGGCTTTAAGGGTTCCCG-3¢K2 5¢-ATGGTACCGGAAGGAAAGCAGAGCCC-3¢K1 5¢-ATGGTACCTGGTGATCCAGGGCTTGC-3¢Sac ... ResearchLaboratories, Japan Tobacco Inc.) for his helpful discussion. We arealso grateful Ms Nami Kawai and Ms Yoko Kawame for theirtechnical assistance. This work was supported in part by a...
  • 9
  • 562
  • 0

Xem thêm

Từ khóa: tài liệu báo cáo khoa học bản chất của khủng hoảng kinh tế thế giới pdftài liệu báo cáo nghiên cứu khoa họctài liệu về báo cáo khoa họcbáo cáo khoa học tài chính côngbáo cáo khoa học số loài quý hiếm tại vườn quốc gia ba bểtai lieu bao cao thuc tap khoa co khiBáo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018Báo cáo quy trình mua hàng CT CP Công Nghệ NPVchuyên đề điện xoay chiều theo dạngNghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANNGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDEPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùngThơ nôm tứ tuyệt trào phúng hồ xuân hươngSở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2chuong 1 tong quan quan tri rui roChiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015Đổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namMÔN TRUYỀN THÔNG MARKETING TÍCH HỢP