0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Tài liệu Báo cáo khoa học: Fish and molluscan metallothioneins A structural and functional comparison ppt

Tài liệu Báo cáo khoa học: The nuclear lamina Both a structural framework and a platform for genome organization pdf

Tài liệu Báo cáo khoa học: The nuclear lamina Both a structural framework and a platform for genome organization pdf

... AM, Columbaro M, Scarano G, MattioliE, Sabatelli P, et al. (2005) Alterations of nuclear envel-ope and chromatin organization in mandibuloacral dys-plasia, a rare form of laminopathy. Physiol ... forms inmammals, designated A- type (lamin A and lamin C) and B-type (lamin B1 and lamin B2), in addition to anincreasing number of associated proteins [4]. Laminswere originally isolated from ... thegenome: a marriage made by evolution. Chromosoma114, 212–219.32 Glass CA, Glass JR, Taniura H, Hasel KW, Blevitt JM& Gerace L (1993) The alpha-helical rod domain ofhuman lamins A and C contains...
  • 8
  • 510
  • 0
Tài liệu Báo cáo khoa học: Fish and molluscan metallothioneins A structural and functional comparison ppt

Tài liệu Báo cáo khoa học: Fish and molluscan metallothioneins A structural and functional comparison ppt

... The Authors. Journal compilation ª 2005 FEBS 6023 Fish and molluscan metallothioneins A structural and functional comparison Laura Vergani1, Myriam Grattarola1, Cristina Borghi2, Francesco ... weadded a BamHI site upstream from the ATG codon, usingthe 5¢-end primer (5¢-CTACTACGAATTAGGATCCCCTGCACCTTG-3¢) and the 3¢-end primer (5¢-GTAATACGACTCACTATAGGGCGAATTGGG-3¢). Amplification wasperformed ... On the otherhand, in crab (Scylla serrata and Cancer pagurus) thetwo domains bind three bivalent metals each [20–22].In comparison with mammalians, molluscan MTs usu-ally have higher glycine...
  • 10
  • 414
  • 0
Tài liệu Báo cáo khoa học: Secondary substrate binding strongly affects activity and binding affinity of Bacillus subtilis and Aspergillus niger GH11 xylanases docx

Tài liệu Báo cáo khoa học: Secondary substrate binding strongly affects activity and binding affinity of Bacillus subtilis and Aspergillus niger GH11 xylanases docx

... xylanase mutants with a modified secondary binding site to water-unextractable arabinoxylan (WU-AX) (A) and oat spelt xylan (OSX) (B) and of A. niger xylanase mutants to water-unextractable arabinoxylan ... X6is a soluble, linear, oligomeric substrate.Xylazyme AX and Azo-wheat AX are polymeric chromo-phoric AX that are water-unextractable and water-extractable, respectively. Water-unextractable AX ... Venkataraman V, SaitHBR, Kasinathan C & Ramasubbu N (2008) Probingthe role of aromatic residues at the secondary saccha-ride-binding sites of human salivary alpha-amylase insubstrate...
  • 14
  • 600
  • 0
Tài liệu Báo cáo khoa học: Amprenavir complexes with HIV-1 protease and its drug-resistant mutants altering hydrophobic clusters docx

Tài liệu Báo cáo khoa học: Amprenavir complexes with HIV-1 protease and its drug-resistant mutants altering hydrophobic clusters docx

... iweber@gsu.edu*Present addressBioscience Division, MS M888, Los AlamosNational Laboratory, Los Alamos, NM, USADatabaseThe atomic coordinates and structurefactors are available in the Protein DataBank with accession ... sidechains of Asp30 and Asp30¢ accommodate diverse functional groups at P2 and P2¢ of SQV and APV atthe surface of the PR active site cavity. The functional group can be critical for a tight ... Atlanta, GA, USA2 Department of Computer Science, Molecular Basis of Disease Program, Georgia State Univers’ity, Atlanta, GA, USA3 Department of Chemistry, Molecular Basis of Disease Program,...
  • 16
  • 582
  • 0
Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

... infection, as assessed bythe mitochondrial release of cytochrome c, caspase-9 and caspase-3 activa-tion, and DNA fragmentation. In an in vitro assay, intact ETA inducedADP-ribosylation of EF-2 and ... (h)AEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLHYSMVLEGGNDALKLAIDNALSITSDGLTIRLEGGVEPNKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGNQLSHMSPIYTIEMGDELLAKLARDATFFVRAHESNEMQPTLAISHAGVSVVMAQTQPRREKRWSEWASGKVLCLLDPLDGVYNYLAQQRCNLDDTWEGKIYRVLAGNPAKHDLDIKPTVISHRLHFPEGGSLAALTAHQACHLPLETFTRHRQPR2791ETA-B280GWEQLEQCGYPVQRLVALYLAARLSWNQVDQVIRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVVSLTCPVAAGECAGPADSGDALLERNYPTGAEFLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYVFVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGALLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWPETA -A LAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKPPREDLK613 A BFig. ... indicate the mobilities of intact ETA ( 66 kDa), ETA -A ( 37 kDa), and unknown degradation fragments. Molecular massmarkers are indicated to the left. ETA and ETA -A signals werequantified by scanning...
  • 15
  • 588
  • 0
Tài liệu Báo cáo khoa học: Solution structure of hirsutellin A – new insights into the active site and interacting interfaces of ribotoxins docx

Tài liệu Báo cáo khoa học: Solution structure of hirsutellin A – new insights into the active site and interacting interfaces of ribotoxins docx

... one a- helix, a helical turn and seven b-strands thatform an N-terminal hairpin and an anti-parallel b-sheet, with a characteris-tic a + b fold and a highly positive charged surface. Compared ... delPozo A & Gavilanes JG (2001) RNase U2 and alpha-sarcin: a study of relationships. Meth Enzymol 341,335–351.3 Lacadena J, A ´lvarez-Garcı´ a E, Carreras-Sangra N,Herrero-Gala´n E, Alegre-Cebollada ... SpainFax ⁄ Tel: +34 91 561 94 00E-mail: mbruix@iqfr.csic.esDatabase Structural data has been submitted to theProtein Data Bank and BioMagResBankdatabases under the accession numbers2kaa and...
  • 10
  • 607
  • 0
Tài liệu Báo cáo khoa học: Pyruvate reduces DNA damage during hypoxia and after reoxygenation in hepatocellular carcinoma cells pptx

Tài liệu Báo cáo khoa học: Pyruvate reduces DNA damage during hypoxia and after reoxygenation in hepatocellular carcinoma cells pptx

... NV (2001) Acutehypoxia and hypoxic exercise induce DNA strandbreaks and oxidative DNA damage in humans. FASEBJ 15, 1181–1186.33 Speit G & Hartmann A (2006) The comet assay: a sensi-tive ... antioxidant and redoxpotential regulator that plays a vital role in drugdetoxification and in cellular protection againstdamage by free radicals, peroxides, and toxins [13].Hypoxia enhances ... without and with pyruvate(0.8 mm). DNA fragmentation was estimated with thecomet assay. The assay was carried out immediatelyafter the 6 h incubation period, and then 1 and 2 hafter reoxygenation...
  • 11
  • 479
  • 0
Tài liệu Báo cáo khoa học: The stereochemistry of benzo[a]pyrene-2¢-deoxyguanosine adducts affects DNA methylation by SssI and HhaI DNA methyltransferases pptx

Tài liệu Báo cáo khoa học: The stereochemistry of benzo[a]pyrene-2¢-deoxyguanosine adducts affects DNA methylation by SssI and HhaI DNA methyltransferases pptx

... benzo [a] pyrene-2¢-deoxyguanosineadducts affects DNA methylation by SssI and HhaI DNAmethyltransferasesOksana M. Subach1, Diana V. Maltseva1, Anant Shastry2, Alexander Kolbanovskiy2,Saulius Klimasˇauskas3, ... Wyszynski MW, Gabbara S, Kubareva EA, RomanovaEA, Oretskaya TS, Gromova ES, Shabarova ZA &Bhagwat AS (1993) The cysteine conserved amongDNA cytosine methylases is required for methyl trans-fer, ... constant; M.SssI, SssI DNA methyltransferase;M.HhaI, HhaI DNA methyltransferase; MTase, DNA methyltransferase; V0, initial rate of methylation; Vmax, maximal rate of methylation.FEBS Journal...
  • 14
  • 558
  • 0
Tài liệu Báo cáo khoa học: Mechanism of dihydroneopterin aldolase NMR, equilibrium and transient kinetic studies of the Staphylococcus aureus and Escherichia coli enzymes docx

Tài liệu Báo cáo khoa học: Mechanism of dihydroneopterin aldolase NMR, equilibrium and transient kinetic studies of the Staphylococcus aureus and Escherichia coli enzymes docx

... Restrictionenzymes and T4 ligase were purchased from New EnglandBiolabs (Ipswich, MA, USA). Pfu DNA polymerase and the pET-17b vector were purchased from Stratagene(La Jolla, CA, USA) and Novagen (Madison, ... intermediate as thatof the aldolase reaction and that SaDHNA and EcDHNA have significantly different equilibrium and kinetic constants, which form the basis for elucidatingthe catalytic mechanism ... from Staphylococcus aureus (SaDHNA) and its complex with the product HP [8]. In the same year,Haussmann and coworkers demonstrated that theenzyme has both aldolase and epimerase activities and determined...
  • 13
  • 479
  • 0
Tài liệu Báo cáo khoa học: Inhibition of pneumococcal choline-binding proteins and cell growth by esters of bicyclic amines pptx

Tài liệu Báo cáo khoa học: Inhibition of pneumococcal choline-binding proteins and cell growth by esters of bicyclic amines pptx

... same high-affinitybehavior for choline analogs and become saturated at2mm (Fig. 2A) , and agrees with the higher apparentaffinity of ipratropium and atropine than of cholinefor C-LytA (Table 1, ... ofC-LytA at 20 °C and pH 7.0, showing two maxima at265 nm and 290 nm. Upon addition of 20 mm choline (a saturating concentration of ligand), two minima at284 nm and 294 nm appear, whereas the ... of Atropa belladonna, and isused as a sympathetic cholinergic blocking drug in pre-medication for anesthesia and in ophthalmology. Onthe other hand, ipratropium is also an anticholinergicagent...
  • 13
  • 465
  • 0

Xem thêm

Từ khóa: Báo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018Nghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitNGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDETrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Nghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chếNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinQuản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtGiáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘIĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namHIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀM